RH08410.complete Sequence
468 bp (468 high quality bases) assembled on 2002-04-21
GenBank Submission: AY113560
> RH08410.complete
ATAGTACTCAAGTCATCGTTCTCTAGTTCAGAGTTCCGCAGCAGTTACAA
AAAACCAACACAAAAATGGCCAAGCTCGCAATTTGCATCCTCGTGTTCGC
CCTGTTCGCCTTGGCTCTGTCCGCCCGCGTCCCCCGTGAGGAATCCAATC
CTGCCCAAGAATTTCTTACCAAGGCCCAGGGTGATTTCAACGAATTCATT
GAAAAGTTGAAGGCGTTGGACGCGAAGAAGGTTGAGGGTCTCTTCAAGGA
TGGATTAAATACCGTGCAGGAGGGTCTGCAAAAACTTAACGAAACATTTC
TTCAGGCACCAGCCGCATCCACCTAAGACGTTGTTGGATGGCCATATATC
ATTACATTGAAAACGACTCCAATAAATGTTTTAACTTTAACTTTAGTTGT
TACATACATGAAAACTAAAAAATGAAATTAAAACGTTAATTGTTTTTAGC
ACAAAAAAAAAAAAAAAA
RH08410.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:18:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Nplp2-RA | 627 | Nplp2-RA | 140..594 | 3..457 | 2275 | 100 | Plus |
Nplp2.a | 474 | Nplp2.a | 5..453 | 3..457 | 2160 | 98.6 | Plus |
Nplp2.b | 468 | Nplp2.b | 5..239 | 3..237 | 1175 | 100 | Plus |
Nplp2.b | 468 | Nplp2.b | 237..447 | 247..457 | 1055 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:54:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3L | 24539361 | chr3L | 13347233..13347450 | 235..452 | 1090 | 100 | Plus |
chr3L | 24539361 | chr3L | 13346955..13347081 | 111..237 | 635 | 100 | Plus |
chr3L | 24539361 | chr3L | 13346764..13346871 | 3..110 | 540 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:20:38 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:54:35
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 13357006..13357228 | 235..457 | 1115 | 100 | Plus |
3L | 28110227 | 3L | 13356727..13356853 | 111..237 | 635 | 100 | Plus |
3L | 28110227 | 3L | 13356536..13356643 | 3..110 | 540 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:11:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28103327 | 3L | 13350106..13350328 | 235..457 | 1115 | 100 | Plus |
3L | 28103327 | 3L | 13349827..13349953 | 111..237 | 635 | 100 | Plus |
3L | 28103327 | 3L | 13349636..13349743 | 3..110 | 540 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-16 12:54:35 has no hits.
RH08410.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:55:20 Download gff for
RH08410.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3L | 13346761..13346871 | 1..110 | 99 | -> | Plus |
chr3L | 13346955..13347080 | 111..236 | 100 | -> | Plus |
chr3L | 13347235..13347450 | 237..452 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:40:20 Download gff for
RH08410.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Nplp2-RA | 1..261 | 66..326 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:32:58 Download gff for
RH08410.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Nplp2-RA | 1..261 | 66..326 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:13:44 Download gff for
RH08410.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Nplp2-RA | 1..261 | 66..326 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:07:00 Download gff for
RH08410.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Nplp2-RA | 1..261 | 66..326 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:11:44 Download gff for
RH08410.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Nplp2-RC | 1..360 | 66..425 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:04:25 Download gff for
RH08410.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Nplp2-RA | 1..453 | 1..452 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:32:58 Download gff for
RH08410.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Nplp2-RA | 1..453 | 1..452 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:13:44 Download gff for
RH08410.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Nplp2-RA | 1..452 | 2..452 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:07:00 Download gff for
RH08410.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Nplp2-RA | 1..453 | 1..452 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:11:44 Download gff for
RH08410.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Nplp2-RA | 1..452 | 2..452 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:55:20 Download gff for
RH08410.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 13357008..13357223 | 237..452 | 100 | | Plus |
3L | 13356533..13356643 | 1..110 | 99 | -> | Plus |
3L | 13356727..13356852 | 111..236 | 100 | -> | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:55:20 Download gff for
RH08410.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 13357008..13357223 | 237..452 | 100 | | Plus |
3L | 13356533..13356643 | 1..110 | 99 | -> | Plus |
3L | 13356727..13356852 | 111..236 | 100 | -> | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:55:20 Download gff for
RH08410.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 13357008..13357223 | 237..452 | 100 | | Plus |
3L | 13356533..13356643 | 1..110 | 99 | -> | Plus |
3L | 13356727..13356852 | 111..236 | 100 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:13:44 Download gff for
RH08410.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 13349633..13349743 | 1..110 | 99 | -> | Plus |
arm_3L | 13349827..13349952 | 111..236 | 100 | -> | Plus |
arm_3L | 13350108..13350323 | 237..452 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:57:33 Download gff for
RH08410.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 13349633..13349743 | 1..110 | 99 | -> | Plus |
3L | 13349827..13349952 | 111..236 | 100 | -> | Plus |
3L | 13350108..13350323 | 237..452 | 100 | | Plus |
RH08410.pep Sequence
Translation from 65 to 325
> RH08410.pep
MAKLAICILVFALFALALSARVPREESNPAQEFLTKAQGDFNEFIEKLKA
LDAKKVEGLFKDGLNTVQEGLQKLNETFLQAPAAST*
RH08410.pep Blast Records
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:04:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG15635-PA | 86 | GG15635-PA | 1..86 | 1..86 | 160 | 39.5 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:36:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Nplp2-PB | 86 | CG11051-PB | 1..86 | 1..86 | 422 | 100 | Plus |
Nplp2-PA | 86 | CG11051-PA | 1..86 | 1..86 | 422 | 100 | Plus |
Nplp2-PC | 119 | CG11051-PC | 1..86 | 1..86 | 422 | 100 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:04:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM25413-PA | 88 | GM25413-PA | 1..88 | 1..86 | 231 | 59.6 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:04:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD14443-PA | 89 | GD14443-PA | 1..89 | 1..86 | 245 | 59.3 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:04:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\Nplp2-PA | 85 | GE21963-PA | 1..85 | 1..85 | 134 | 42.4 | Plus |
RH08410.hyp Sequence
Translation from 65 to 325
> RH08410.hyp
MAKLAICILVFALFALALSARVPREESNPAQEFLTKAQGDFNEFIEKLKA
LDAKKVEGLFKDGLNTVQEGLQKLNETFLQAPAAST*
RH08410.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:14:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Nplp2-PB | 86 | CG11051-PB | 1..86 | 1..86 | 422 | 100 | Plus |
Nplp2-PA | 86 | CG11051-PA | 1..86 | 1..86 | 422 | 100 | Plus |
Nplp2-PC | 119 | CG11051-PC | 1..86 | 1..86 | 422 | 100 | Plus |