Clone RH08410 Report

Search the DGRC for RH08410

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:84
Well:10
Vector:pFlc-1
Associated Gene/TranscriptNplp2-RA
Protein status:RH08410.pep: gold
Preliminary Size:445
Sequenced Size:468

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11051 2002-01-01 Sim4 clustering to Release 2
CG11051 2002-04-21 Blastp of sequenced clone
CG11051 2003-01-01 Sim4 clustering to Release 3
Nplp2 2008-04-29 Release 5.5 accounting
Nplp2 2008-08-15 Release 5.9 accounting
Nplp2 2008-12-18 5.12 accounting

Clone Sequence Records

RH08410.complete Sequence

468 bp (468 high quality bases) assembled on 2002-04-21

GenBank Submission: AY113560

> RH08410.complete
ATAGTACTCAAGTCATCGTTCTCTAGTTCAGAGTTCCGCAGCAGTTACAA
AAAACCAACACAAAAATGGCCAAGCTCGCAATTTGCATCCTCGTGTTCGC
CCTGTTCGCCTTGGCTCTGTCCGCCCGCGTCCCCCGTGAGGAATCCAATC
CTGCCCAAGAATTTCTTACCAAGGCCCAGGGTGATTTCAACGAATTCATT
GAAAAGTTGAAGGCGTTGGACGCGAAGAAGGTTGAGGGTCTCTTCAAGGA
TGGATTAAATACCGTGCAGGAGGGTCTGCAAAAACTTAACGAAACATTTC
TTCAGGCACCAGCCGCATCCACCTAAGACGTTGTTGGATGGCCATATATC
ATTACATTGAAAACGACTCCAATAAATGTTTTAACTTTAACTTTAGTTGT
TACATACATGAAAACTAAAAAATGAAATTAAAACGTTAATTGTTTTTAGC
ACAAAAAAAAAAAAAAAA

RH08410.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:18:49
Subject Length Description Subject Range Query Range Score Percent Strand
Nplp2-RA 627 Nplp2-RA 140..594 3..457 2275 100 Plus
Nplp2.a 474 Nplp2.a 5..453 3..457 2160 98.6 Plus
Nplp2.b 468 Nplp2.b 5..239 3..237 1175 100 Plus
Nplp2.b 468 Nplp2.b 237..447 247..457 1055 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:54:37
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 13347233..13347450 235..452 1090 100 Plus
chr3L 24539361 chr3L 13346955..13347081 111..237 635 100 Plus
chr3L 24539361 chr3L 13346764..13346871 3..110 540 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:20:38 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:54:35
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 13357006..13357228 235..457 1115 100 Plus
3L 28110227 3L 13356727..13356853 111..237 635 100 Plus
3L 28110227 3L 13356536..13356643 3..110 540 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:11:50
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 13350106..13350328 235..457 1115 100 Plus
3L 28103327 3L 13349827..13349953 111..237 635 100 Plus
3L 28103327 3L 13349636..13349743 3..110 540 100 Plus
Blast to na_te.dros performed on 2019-03-16 12:54:35 has no hits.

RH08410.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:55:20 Download gff for RH08410.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 13346761..13346871 1..110 99 -> Plus
chr3L 13346955..13347080 111..236 100 -> Plus
chr3L 13347235..13347450 237..452 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:40:20 Download gff for RH08410.complete
Subject Subject Range Query Range Percent Splice Strand
Nplp2-RA 1..261 66..326 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:32:58 Download gff for RH08410.complete
Subject Subject Range Query Range Percent Splice Strand
Nplp2-RA 1..261 66..326 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:13:44 Download gff for RH08410.complete
Subject Subject Range Query Range Percent Splice Strand
Nplp2-RA 1..261 66..326 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:07:00 Download gff for RH08410.complete
Subject Subject Range Query Range Percent Splice Strand
Nplp2-RA 1..261 66..326 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:11:44 Download gff for RH08410.complete
Subject Subject Range Query Range Percent Splice Strand
Nplp2-RC 1..360 66..425 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:04:25 Download gff for RH08410.complete
Subject Subject Range Query Range Percent Splice Strand
Nplp2-RA 1..453 1..452 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:32:58 Download gff for RH08410.complete
Subject Subject Range Query Range Percent Splice Strand
Nplp2-RA 1..453 1..452 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:13:44 Download gff for RH08410.complete
Subject Subject Range Query Range Percent Splice Strand
Nplp2-RA 1..452 2..452 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:07:00 Download gff for RH08410.complete
Subject Subject Range Query Range Percent Splice Strand
Nplp2-RA 1..453 1..452 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:11:44 Download gff for RH08410.complete
Subject Subject Range Query Range Percent Splice Strand
Nplp2-RA 1..452 2..452 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:55:20 Download gff for RH08410.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13357008..13357223 237..452 100   Plus
3L 13356533..13356643 1..110 99 -> Plus
3L 13356727..13356852 111..236 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:55:20 Download gff for RH08410.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13357008..13357223 237..452 100   Plus
3L 13356533..13356643 1..110 99 -> Plus
3L 13356727..13356852 111..236 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:55:20 Download gff for RH08410.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13357008..13357223 237..452 100   Plus
3L 13356533..13356643 1..110 99 -> Plus
3L 13356727..13356852 111..236 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:13:44 Download gff for RH08410.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 13349633..13349743 1..110 99 -> Plus
arm_3L 13349827..13349952 111..236 100 -> Plus
arm_3L 13350108..13350323 237..452 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:57:33 Download gff for RH08410.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13349633..13349743 1..110 99 -> Plus
3L 13349827..13349952 111..236 100 -> Plus
3L 13350108..13350323 237..452 100   Plus

RH08410.pep Sequence

Translation from 65 to 325

> RH08410.pep
MAKLAICILVFALFALALSARVPREESNPAQEFLTKAQGDFNEFIEKLKA
LDAKKVEGLFKDGLNTVQEGLQKLNETFLQAPAAST*

RH08410.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:04:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15635-PA 86 GG15635-PA 1..86 1..86 160 39.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:36:39
Subject Length Description Subject Range Query Range Score Percent Strand
Nplp2-PB 86 CG11051-PB 1..86 1..86 422 100 Plus
Nplp2-PA 86 CG11051-PA 1..86 1..86 422 100 Plus
Nplp2-PC 119 CG11051-PC 1..86 1..86 422 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:04:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25413-PA 88 GM25413-PA 1..88 1..86 231 59.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:04:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14443-PA 89 GD14443-PA 1..89 1..86 245 59.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:04:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\Nplp2-PA 85 GE21963-PA 1..85 1..85 134 42.4 Plus

RH08410.hyp Sequence

Translation from 65 to 325

> RH08410.hyp
MAKLAICILVFALFALALSARVPREESNPAQEFLTKAQGDFNEFIEKLKA
LDAKKVEGLFKDGLNTVQEGLQKLNETFLQAPAAST*

RH08410.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:14:37
Subject Length Description Subject Range Query Range Score Percent Strand
Nplp2-PB 86 CG11051-PB 1..86 1..86 422 100 Plus
Nplp2-PA 86 CG11051-PA 1..86 1..86 422 100 Plus
Nplp2-PC 119 CG11051-PC 1..86 1..86 422 100 Plus