BDGP Sequence Production Resources |
Search the DGRC for RH08487
Library: | RH |
Tissue Source: | Drosophila melanogaster adult head |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2001-04-30 |
Comments: | Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 84 |
Well: | 87 |
Vector: | pFlc-1 |
Associated Gene/Transcript | Pdf-RA |
Protein status: | RH08487.pep: gold |
Preliminary Size: | 309 |
Sequenced Size: | 696 |
Gene | Date | Evidence |
---|---|---|
CG6496 | 2002-01-01 | Sim4 clustering to Release 2 |
CG6496 | 2002-06-11 | Blastp of sequenced clone |
CG6496 | 2003-01-01 | Sim4 clustering to Release 3 |
2008-04-29 | Release 5.5 accounting | |
2008-08-15 | Release 5.9 accounting | |
2008-12-18 | 5.12 accounting |
696 bp (696 high quality bases) assembled on 2002-06-11
GenBank Submission: AY071681
> RH08487.complete GATTCATTCGCAAGTCTCCTGCTGCAGGTGTTCCGTGCTCAGTTCCTGCT CCTGGCCATCCTTCCAGCTCCTCGGACTAATGGCTCGCTACACGTACCTT GTCGCCCTTGTGCTTCTGGCCATTTGCTGCCAGTGGGGATACTGCGGCGC CATGGCCATGCCGGATGAGGAGCGCTATGTGCGCAAGGAGTACAATCGGG ATCTCCTCGACTGGTTCAACAACGTGGGCGTGGGACAGTTCAGTCCCGGC CAAGTGGCCACTCTCTGTCGCTATCCGCTGATCCTCGAGAACTCCTTGGG CCCATCCGTGCCCATCAGGAAGCGCAACTCGGAGCTAATCAACTCCTTGT TGAGTCTGCCCAAGAACATGAACGATGCGGGCAAGTAAGAACGGAAAATG CTGAAGGATTAGGACGACCCACCACTGAAAGATGGAACCTGGACAAGAAT TTATTATTTGATGTTATAGTATGATTTTTTGGTGCGTCGAAGGAAAATGA AAATCCGCAGATAAAAGCCGGTGTAGTCATCTAATAGAGAGAAAAGACCG TATAACTTTTGTTGCTTTAAACCTAAATAGAAAAATATACAAGTAGCCTA TTGTAGAAATGTTGTATATTATTAGGCTTACTGCTGAAATAAACGTTTTC TGGATTGTTTCGACTTGAAATCTGGTACAACAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Pdf-RA | 680 | Pdf-RA | 2..680 | 3..681 | 3395 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 22278485..22279163 | 681..3 | 3305 | 99.1 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 26455460..26456140 | 683..3 | 3405 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 26196291..26196971 | 683..3 | 3405 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 22278485..22279164 | 1..681 | 98 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Pdf-RA | 1..309 | 80..388 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Pdf-RA | 1..309 | 80..388 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Pdf-RA | 1..309 | 80..388 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Pdf-RA | 1..309 | 80..388 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Pdf-RA | 1..309 | 80..388 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Pdf-RA | 2..680 | 3..681 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Pdf-RA | 2..680 | 3..681 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Pdf-RA | 2..680 | 3..681 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Pdf-RA | 2..680 | 3..681 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Pdf-RA | 2..680 | 3..681 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 26455462..26456141 | 1..681 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 26455462..26456141 | 1..681 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 26455462..26456141 | 1..681 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 22281184..22281863 | 1..681 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 26196293..26196972 | 1..681 | 99 | Minus |
Translation from 0 to 387
> RH08487.hyp VHSQVSCCRCSVLSSCSWPSFQLLGLMARYTYLVALVLLAICCQWGYCGA MAMPDEERYVRKEYNRDLLDWFNNVGVGQFSPGQVATLCRYPLILENSLG PSVPIRKRNSELINSLLSLPKNMNDAGK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Pdf-PA | 102 | CG6496-PA | 1..102 | 27..128 | 545 | 100 | Plus |
Translation from 79 to 387
> RH08487.pep MARYTYLVALVLLAICCQWGYCGAMAMPDEERYVRKEYNRDLLDWFNNVG VGQFSPGQVATLCRYPLILENSLGPSVPIRKRNSELINSLLSLPKNMNDA GK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF18882-PA | 98 | GF18882-PA | 1..98 | 1..102 | 394 | 77.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG12188-PA | 104 | GG12188-PA | 1..104 | 1..102 | 484 | 89.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH14136-PA | 93 | GH14136-PA | 18..93 | 22..102 | 194 | 53.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Pdf-PA | 102 | CG6496-PA | 1..102 | 1..102 | 545 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI10669-PA | 99 | GI10669-PA | 24..99 | 26..102 | 237 | 66.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL24178-PA | 97 | GL24178-PA | 1..97 | 1..101 | 316 | 61.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA19638-PA | 97 | GA19638-PA | 1..97 | 1..101 | 316 | 61.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM10183-PA | 102 | GM10183-PA | 1..102 | 1..102 | 517 | 97.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD18135-PA | 102 | GD18135-PA | 1..102 | 1..102 | 532 | 99 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\Pdf-PA | 99 | GJ23022-PA | 17..99 | 15..102 | 250 | 61.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK11356-PA | 100 | GK11356-PA | 1..100 | 1..102 | 288 | 65.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE10630-PA | 104 | GE10630-PA | 1..104 | 1..102 | 499 | 92.3 | Plus |