Clone RH08487 Report

Search the DGRC for RH08487

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:84
Well:87
Vector:pFlc-1
Associated Gene/TranscriptPdf-RA
Protein status:RH08487.pep: gold
Preliminary Size:309
Sequenced Size:696

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6496 2002-01-01 Sim4 clustering to Release 2
CG6496 2002-06-11 Blastp of sequenced clone
CG6496 2003-01-01 Sim4 clustering to Release 3
Pdf 2008-04-29 Release 5.5 accounting
Pdf 2008-08-15 Release 5.9 accounting
Pdf 2008-12-18 5.12 accounting

Clone Sequence Records

RH08487.complete Sequence

696 bp (696 high quality bases) assembled on 2002-06-11

GenBank Submission: AY071681

> RH08487.complete
GATTCATTCGCAAGTCTCCTGCTGCAGGTGTTCCGTGCTCAGTTCCTGCT
CCTGGCCATCCTTCCAGCTCCTCGGACTAATGGCTCGCTACACGTACCTT
GTCGCCCTTGTGCTTCTGGCCATTTGCTGCCAGTGGGGATACTGCGGCGC
CATGGCCATGCCGGATGAGGAGCGCTATGTGCGCAAGGAGTACAATCGGG
ATCTCCTCGACTGGTTCAACAACGTGGGCGTGGGACAGTTCAGTCCCGGC
CAAGTGGCCACTCTCTGTCGCTATCCGCTGATCCTCGAGAACTCCTTGGG
CCCATCCGTGCCCATCAGGAAGCGCAACTCGGAGCTAATCAACTCCTTGT
TGAGTCTGCCCAAGAACATGAACGATGCGGGCAAGTAAGAACGGAAAATG
CTGAAGGATTAGGACGACCCACCACTGAAAGATGGAACCTGGACAAGAAT
TTATTATTTGATGTTATAGTATGATTTTTTGGTGCGTCGAAGGAAAATGA
AAATCCGCAGATAAAAGCCGGTGTAGTCATCTAATAGAGAGAAAAGACCG
TATAACTTTTGTTGCTTTAAACCTAAATAGAAAAATATACAAGTAGCCTA
TTGTAGAAATGTTGTATATTATTAGGCTTACTGCTGAAATAAACGTTTTC
TGGATTGTTTCGACTTGAAATCTGGTACAACAAAAAAAAAAAAAAA

RH08487.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:49:17
Subject Length Description Subject Range Query Range Score Percent Strand
Pdf-RA 680 Pdf-RA 2..680 3..681 3395 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:20:17
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 22278485..22279163 681..3 3305 99.1 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:20:41 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:20:15
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 26455460..26456140 683..3 3405 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:22:05
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 26196291..26196971 683..3 3405 100 Minus
Blast to na_te.dros performed on 2019-03-15 20:20:15 has no hits.

RH08487.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:21:23 Download gff for RH08487.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 22278485..22279164 1..681 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:40:23 Download gff for RH08487.complete
Subject Subject Range Query Range Percent Splice Strand
Pdf-RA 1..309 80..388 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:24:52 Download gff for RH08487.complete
Subject Subject Range Query Range Percent Splice Strand
Pdf-RA 1..309 80..388 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 03:06:28 Download gff for RH08487.complete
Subject Subject Range Query Range Percent Splice Strand
Pdf-RA 1..309 80..388 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:15:25 Download gff for RH08487.complete
Subject Subject Range Query Range Percent Splice Strand
Pdf-RA 1..309 80..388 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:34:19 Download gff for RH08487.complete
Subject Subject Range Query Range Percent Splice Strand
Pdf-RA 1..309 80..388 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:52:29 Download gff for RH08487.complete
Subject Subject Range Query Range Percent Splice Strand
Pdf-RA 2..680 3..681 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:24:52 Download gff for RH08487.complete
Subject Subject Range Query Range Percent Splice Strand
Pdf-RA 2..680 3..681 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:06:28 Download gff for RH08487.complete
Subject Subject Range Query Range Percent Splice Strand
Pdf-RA 2..680 3..681 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:15:25 Download gff for RH08487.complete
Subject Subject Range Query Range Percent Splice Strand
Pdf-RA 2..680 3..681 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:34:19 Download gff for RH08487.complete
Subject Subject Range Query Range Percent Splice Strand
Pdf-RA 2..680 3..681 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:21:23 Download gff for RH08487.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26455462..26456141 1..681 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:21:23 Download gff for RH08487.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26455462..26456141 1..681 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:21:23 Download gff for RH08487.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26455462..26456141 1..681 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:06:28 Download gff for RH08487.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 22281184..22281863 1..681 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:48:32 Download gff for RH08487.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26196293..26196972 1..681 99   Minus

RH08487.hyp Sequence

Translation from 0 to 387

> RH08487.hyp
VHSQVSCCRCSVLSSCSWPSFQLLGLMARYTYLVALVLLAICCQWGYCGA
MAMPDEERYVRKEYNRDLLDWFNNVGVGQFSPGQVATLCRYPLILENSLG
PSVPIRKRNSELINSLLSLPKNMNDAGK*

RH08487.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:50:57
Subject Length Description Subject Range Query Range Score Percent Strand
Pdf-PA 102 CG6496-PA 1..102 27..128 545 100 Plus

RH08487.pep Sequence

Translation from 79 to 387

> RH08487.pep
MARYTYLVALVLLAICCQWGYCGAMAMPDEERYVRKEYNRDLLDWFNNVG
VGQFSPGQVATLCRYPLILENSLGPSVPIRKRNSELINSLLSLPKNMNDA
GK*

RH08487.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:48:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18882-PA 98 GF18882-PA 1..98 1..102 394 77.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:48:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12188-PA 104 GG12188-PA 1..104 1..102 484 89.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:48:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14136-PA 93 GH14136-PA 18..93 22..102 194 53.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:03:55
Subject Length Description Subject Range Query Range Score Percent Strand
Pdf-PA 102 CG6496-PA 1..102 1..102 545 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:48:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10669-PA 99 GI10669-PA 24..99 26..102 237 66.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:48:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24178-PA 97 GL24178-PA 1..97 1..101 316 61.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:48:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19638-PA 97 GA19638-PA 1..97 1..101 316 61.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:48:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10183-PA 102 GM10183-PA 1..102 1..102 517 97.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:48:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18135-PA 102 GD18135-PA 1..102 1..102 532 99 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:48:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Pdf-PA 99 GJ23022-PA 17..99 15..102 250 61.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:48:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11356-PA 100 GK11356-PA 1..100 1..102 288 65.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:48:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10630-PA 104 GE10630-PA 1..104 1..102 499 92.3 Plus