Clone RH08745 Report

Search the DGRC for RH08745

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:87
Well:45
Vector:pFlc-1
Associated Gene/TranscriptIM1-RA
Protein status:RH08745.pep: gold
Preliminary Size:340
Sequenced Size:374

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG18108 2002-01-01 Sim4 clustering to Release 2
IM1 2008-04-29 Release 5.5 accounting
IM1 2008-08-15 Release 5.9 accounting
IM1 2008-12-18 5.12 accounting

Clone Sequence Records

RH08745.complete Sequence

374 bp (374 high quality bases) assembled on 2002-05-03

GenBank Submission: AY102698.1

> RH08745.complete
GATCAGTTCAATCCAATCAATTGCCCAGTGCACTCAGTATCCAAAACCGG
AGAAATCCATCCAGAATCAATATGAAATTCTTCTCAGTCGTCACCGTTTT
TGTGCTCGGTCTGCTGGCTGTGGCCAATGCTGTTCCACTGTCGCCCGATC
CAGGAAATGTGATCATCAATGGCGATTGCAGGGTGTGCAATGTCCACGGT
GGCAAGTAGGAAGTTTCAACCCAAGGATTCGAAAAAGGACATAGTCTACA
AACTAGAACACAAAAGCTGTTACCATTTTTTACTGGAATAATACATAGAA
TTAAAAATGCAAATCAAAGAAATACATACAAATAGAGGATTCTATTTCCT
TTCTAACTAAAAAAAAAAAAAAAA

RH08745.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:04:45
Subject Length Description Subject Range Query Range Score Percent Strand
IM1-RA 524 IM1-RA 122..486 2..366 1810 99.7 Plus
IM2-RA 472 IM2-RA 162..313 61..212 490 88.1 Plus
CG18107-RA 283 CG18107-RA 66..176 65..175 330 86.4 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:14:44
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 14271201..14271429 129..358 1055 98.3 Plus
chr2R 21145070 chr2R 14271008..14271135 2..129 595 97.7 Plus
chr2R 21145070 chr2R 14273706..14273772 61..127 275 94 Plus
chr2R 21145070 chr2R 14273836..14273919 129..212 240 85.7 Plus
chr2R 21145070 chr2R 14271805..14271895 129..219 215 82.4 Plus
chr2R 21145070 chr2R 14271655..14271745 43..133 200 81.3 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:20:47 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:14:43
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18384149..18384386 129..366 1175 99.6 Plus
2R 25286936 2R 18383953..18384080 2..129 640 100 Plus
2R 25286936 2R 18386662..18386728 61..127 275 94 Plus
2R 25286936 2R 18386792..18386875 129..212 225 84.5 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:59:34
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 18385348..18385585 129..366 1175 99.5 Plus
2R 25260384 2R 18385152..18385279 2..129 640 100 Plus
2R 25260384 2R 18387861..18387927 61..127 275 94 Plus
2R 25260384 2R 18387991..18388074 129..212 225 84.5 Plus
2R 25260384 2R 18385957..18386003 129..175 160 89.3 Plus
2R 25260384 2R 18389519..18389564 148..193 140 86.9 Plus
Blast to na_te.dros performed on 2019-03-16 04:14:43 has no hits.

RH08745.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:15:41 Download gff for RH08745.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 14271007..14271135 1..129 96 -> Plus
chr2R 14271202..14271429 130..358 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:40:28 Download gff for RH08745.complete
Subject Subject Range Query Range Percent Splice Strand
IM1-RA 1..138 72..209 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:04:09 Download gff for RH08745.complete
Subject Subject Range Query Range Percent Splice Strand
IM1-RA 1..138 72..209 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:22:43 Download gff for RH08745.complete
Subject Subject Range Query Range Percent Splice Strand
IM1-RA 1..138 72..209 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:05:41 Download gff for RH08745.complete
Subject Subject Range Query Range Percent Splice Strand
IM1-RA 1..138 72..209 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:32:43 Download gff for RH08745.complete
Subject Subject Range Query Range Percent Splice Strand
IM1-RA 1..138 72..209 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-27 15:32:38 Download gff for RH08745.complete
Subject Subject Range Query Range Percent Splice Strand
IM1-RA 2..358 2..358 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:04:09 Download gff for RH08745.complete
Subject Subject Range Query Range Percent Splice Strand
IM1-RA 2..358 2..358 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:22:43 Download gff for RH08745.complete
Subject Subject Range Query Range Percent Splice Strand
IM1-RA 4..361 1..358 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:05:42 Download gff for RH08745.complete
Subject Subject Range Query Range Percent Splice Strand
IM1-RA 2..358 2..358 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:32:43 Download gff for RH08745.complete
Subject Subject Range Query Range Percent Splice Strand
IM1-RA 4..361 1..358 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:15:41 Download gff for RH08745.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18383952..18384080 1..129 99 -> Plus
2R 18384150..18384378 130..358 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:15:41 Download gff for RH08745.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18383952..18384080 1..129 99 -> Plus
2R 18384150..18384378 130..358 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:15:41 Download gff for RH08745.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18383952..18384080 1..129 99 -> Plus
2R 18384150..18384378 130..358 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:22:43 Download gff for RH08745.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14271457..14271585 1..129 99 -> Plus
arm_2R 14271655..14271883 130..358 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:38:14 Download gff for RH08745.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18385151..18385279 1..129 99 -> Plus
2R 18385349..18385577 130..358 100   Plus

RH08745.hyp Sequence

Translation from 0 to 243

> RH08745.hyp
ISSIQSIAQCTQYPKPEKSIQNQYEILLSRHRFCARSAGCGQCCSTVARS
RKCDHQWRLQGVQCPRWQVGSFNPRIRKRT*
Sequence RH08745.hyp has no blast hits.

RH08745.pep Sequence

Translation from 2 to 208

> RH08745.pep
SVQSNQLPSALSIQNRRNPSRINMKFFSVVTVFVLGLLAVANAVPLSPDP
GNVIINGDCRVCNVHGGK*

RH08745.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:40:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12155-PA 45 GF12155-PA 1..45 24..68 220 93.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:40:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21874-PA 45 GG21874-PA 1..45 24..68 226 97.8 Plus
Dere\GG21876-PA 45 GG21876-PA 1..45 24..68 214 88.9 Plus
Dere\GG21875-PA 45 GG21875-PA 1..45 24..68 187 80 Plus
Dere\GG21877-PA 39 GG21877-PA 1..39 24..66 139 74.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:20:43
Subject Length Description Subject Range Query Range Score Percent Strand
IM1-PA 45 CG18108-PA 1..45 24..68 236 100 Plus
IM2-PA 45 CG18106-PA 1..45 24..68 220 88.9 Plus
CG18107-PA 45 CG18107-PA 1..45 24..68 202 82.2 Plus
IM3-PB 39 CG16844-PB 1..37 24..64 140 75.6 Plus
IM3-PA 39 CG16844-PA 1..37 24..64 140 75.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:40:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20115-PA 45 GI20115-PA 1..45 24..68 218 91.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:40:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17764-PA 45 GL17764-PA 1..45 24..68 218 91.1 Plus
Dper\GL16705-PA 40 GL16705-PA 1..39 24..66 129 65.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:40:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14796-PA 45 GA14796-PA 1..45 24..68 218 91.1 Plus
Dpse\GA30478-PA 40 GA30478-PA 1..39 24..66 131 67.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:40:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21866-PA 45 GM21866-PA 1..45 24..68 228 100 Plus
Dsec\GM21867-PA 45 GM21867-PA 1..45 24..68 192 84.4 Plus
Dsec\GM21868-PA 45 GM21868-PA 1..45 24..68 161 88.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:40:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11363-PA 45 GD11363-PA 1..45 24..68 226 97.8 Plus
Dsim\GD11365-PA 45 GD11365-PA 1..45 24..68 218 91.1 Plus
Dsim\GD11364-PA 45 GD11364-PA 1..45 24..68 192 82.2 Plus
Dsim\GD11366-PA 39 GD11366-PA 1..39 24..66 138 72.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:40:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19885-PA 45 GJ19885-PA 1..45 24..68 214 88.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:40:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23232-PA 68 GK23232-PA 1..45 24..68 223 91.1 Plus
Dwil\GK22977-PA 45 GK22977-PA 1..45 24..68 218 91.1 Plus
Dwil\GK23235-PA 40 GK23235-PA 1..39 24..66 126 62.8 Plus
Dwil\GK23991-PA 40 GK23991-PA 1..39 24..66 124 62.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:40:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11953-PA 40 GE11953-PA 1..40 24..67 128 65.9 Plus