BDGP Sequence Production Resources |
Search the DGRC for RH08745
Library: | RH |
Tissue Source: | Drosophila melanogaster adult head |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2001-04-30 |
Comments: | Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 87 |
Well: | 45 |
Vector: | pFlc-1 |
Associated Gene/Transcript | IM1-RA |
Protein status: | RH08745.pep: gold |
Preliminary Size: | 340 |
Sequenced Size: | 374 |
Gene | Date | Evidence |
---|---|---|
CG18108 | 2002-01-01 | Sim4 clustering to Release 2 |
IM1 | 2008-04-29 | Release 5.5 accounting |
IM1 | 2008-08-15 | Release 5.9 accounting |
IM1 | 2008-12-18 | 5.12 accounting |
374 bp (374 high quality bases) assembled on 2002-05-03
GenBank Submission: AY102698.1
> RH08745.complete GATCAGTTCAATCCAATCAATTGCCCAGTGCACTCAGTATCCAAAACCGG AGAAATCCATCCAGAATCAATATGAAATTCTTCTCAGTCGTCACCGTTTT TGTGCTCGGTCTGCTGGCTGTGGCCAATGCTGTTCCACTGTCGCCCGATC CAGGAAATGTGATCATCAATGGCGATTGCAGGGTGTGCAATGTCCACGGT GGCAAGTAGGAAGTTTCAACCCAAGGATTCGAAAAAGGACATAGTCTACA AACTAGAACACAAAAGCTGTTACCATTTTTTACTGGAATAATACATAGAA TTAAAAATGCAAATCAAAGAAATACATACAAATAGAGGATTCTATTTCCT TTCTAACTAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 14271201..14271429 | 129..358 | 1055 | 98.3 | Plus |
chr2R | 21145070 | chr2R | 14271008..14271135 | 2..129 | 595 | 97.7 | Plus |
chr2R | 21145070 | chr2R | 14273706..14273772 | 61..127 | 275 | 94 | Plus |
chr2R | 21145070 | chr2R | 14273836..14273919 | 129..212 | 240 | 85.7 | Plus |
chr2R | 21145070 | chr2R | 14271805..14271895 | 129..219 | 215 | 82.4 | Plus |
chr2R | 21145070 | chr2R | 14271655..14271745 | 43..133 | 200 | 81.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 18384149..18384386 | 129..366 | 1175 | 99.6 | Plus |
2R | 25286936 | 2R | 18383953..18384080 | 2..129 | 640 | 100 | Plus |
2R | 25286936 | 2R | 18386662..18386728 | 61..127 | 275 | 94 | Plus |
2R | 25286936 | 2R | 18386792..18386875 | 129..212 | 225 | 84.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 18385348..18385585 | 129..366 | 1175 | 99.5 | Plus |
2R | 25260384 | 2R | 18385152..18385279 | 2..129 | 640 | 100 | Plus |
2R | 25260384 | 2R | 18387861..18387927 | 61..127 | 275 | 94 | Plus |
2R | 25260384 | 2R | 18387991..18388074 | 129..212 | 225 | 84.5 | Plus |
2R | 25260384 | 2R | 18385957..18386003 | 129..175 | 160 | 89.3 | Plus |
2R | 25260384 | 2R | 18389519..18389564 | 148..193 | 140 | 86.9 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 14271007..14271135 | 1..129 | 96 | -> | Plus |
chr2R | 14271202..14271429 | 130..358 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
IM1-RA | 1..138 | 72..209 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
IM1-RA | 1..138 | 72..209 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
IM1-RA | 1..138 | 72..209 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
IM1-RA | 1..138 | 72..209 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
IM1-RA | 1..138 | 72..209 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
IM1-RA | 2..358 | 2..358 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
IM1-RA | 2..358 | 2..358 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
IM1-RA | 4..361 | 1..358 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
IM1-RA | 2..358 | 2..358 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
IM1-RA | 4..361 | 1..358 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 18383952..18384080 | 1..129 | 99 | -> | Plus |
2R | 18384150..18384378 | 130..358 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 18383952..18384080 | 1..129 | 99 | -> | Plus |
2R | 18384150..18384378 | 130..358 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 18383952..18384080 | 1..129 | 99 | -> | Plus |
2R | 18384150..18384378 | 130..358 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 14271457..14271585 | 1..129 | 99 | -> | Plus |
arm_2R | 14271655..14271883 | 130..358 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 18385151..18385279 | 1..129 | 99 | -> | Plus |
2R | 18385349..18385577 | 130..358 | 100 | Plus |
Translation from 0 to 243
> RH08745.hyp ISSIQSIAQCTQYPKPEKSIQNQYEILLSRHRFCARSAGCGQCCSTVARS RKCDHQWRLQGVQCPRWQVGSFNPRIRKRT*
Translation from 2 to 208
> RH08745.pep SVQSNQLPSALSIQNRRNPSRINMKFFSVVTVFVLGLLAVANAVPLSPDP GNVIINGDCRVCNVHGGK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF12155-PA | 45 | GF12155-PA | 1..45 | 24..68 | 220 | 93.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG21874-PA | 45 | GG21874-PA | 1..45 | 24..68 | 226 | 97.8 | Plus |
Dere\GG21876-PA | 45 | GG21876-PA | 1..45 | 24..68 | 214 | 88.9 | Plus |
Dere\GG21875-PA | 45 | GG21875-PA | 1..45 | 24..68 | 187 | 80 | Plus |
Dere\GG21877-PA | 39 | GG21877-PA | 1..39 | 24..66 | 139 | 74.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
IM1-PA | 45 | CG18108-PA | 1..45 | 24..68 | 236 | 100 | Plus |
IM2-PA | 45 | CG18106-PA | 1..45 | 24..68 | 220 | 88.9 | Plus |
CG18107-PA | 45 | CG18107-PA | 1..45 | 24..68 | 202 | 82.2 | Plus |
IM3-PB | 39 | CG16844-PB | 1..37 | 24..64 | 140 | 75.6 | Plus |
IM3-PA | 39 | CG16844-PA | 1..37 | 24..64 | 140 | 75.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI20115-PA | 45 | GI20115-PA | 1..45 | 24..68 | 218 | 91.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL17764-PA | 45 | GL17764-PA | 1..45 | 24..68 | 218 | 91.1 | Plus |
Dper\GL16705-PA | 40 | GL16705-PA | 1..39 | 24..66 | 129 | 65.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA14796-PA | 45 | GA14796-PA | 1..45 | 24..68 | 218 | 91.1 | Plus |
Dpse\GA30478-PA | 40 | GA30478-PA | 1..39 | 24..66 | 131 | 67.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM21866-PA | 45 | GM21866-PA | 1..45 | 24..68 | 228 | 100 | Plus |
Dsec\GM21867-PA | 45 | GM21867-PA | 1..45 | 24..68 | 192 | 84.4 | Plus |
Dsec\GM21868-PA | 45 | GM21868-PA | 1..45 | 24..68 | 161 | 88.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD11363-PA | 45 | GD11363-PA | 1..45 | 24..68 | 226 | 97.8 | Plus |
Dsim\GD11365-PA | 45 | GD11365-PA | 1..45 | 24..68 | 218 | 91.1 | Plus |
Dsim\GD11364-PA | 45 | GD11364-PA | 1..45 | 24..68 | 192 | 82.2 | Plus |
Dsim\GD11366-PA | 39 | GD11366-PA | 1..39 | 24..66 | 138 | 72.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ19885-PA | 45 | GJ19885-PA | 1..45 | 24..68 | 214 | 88.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK23232-PA | 68 | GK23232-PA | 1..45 | 24..68 | 223 | 91.1 | Plus |
Dwil\GK22977-PA | 45 | GK22977-PA | 1..45 | 24..68 | 218 | 91.1 | Plus |
Dwil\GK23235-PA | 40 | GK23235-PA | 1..39 | 24..66 | 126 | 62.8 | Plus |
Dwil\GK23991-PA | 40 | GK23991-PA | 1..39 | 24..66 | 124 | 62.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE11953-PA | 40 | GE11953-PA | 1..40 | 24..67 | 128 | 65.9 | Plus |