Clone RH08789 Report

Search the DGRC for RH08789

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:87
Well:89
Vector:pFlc-1
Associated Gene/Transcriptssp7-RA
Protein status:RH08789.pep: gold
Sequenced Size:384

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG32667 2003-01-01 Sim4 clustering to Release 3
CG32667 2004-01-31 Blastp of sequenced clone
CG32667 2008-04-29 Release 5.5 accounting
CG32667 2008-08-15 Release 5.9 accounting
CG32667 2008-12-18 5.12 accounting

Clone Sequence Records

RH08789.complete Sequence

384 bp (384 high quality bases) assembled on 2004-01-31

GenBank Submission: BT011525

> RH08789.complete
GATCAGTTAGCTACATAATATGAAATCGGTCACGTTCGTACTCTGCCTGC
TCGTTCTGGGCGCCCACTCGCTGCTGGTGTTCGCCGTGGATTGCGAGATC
GGTGGGCATCAGTTCAAGACCGGAGAGAAGTACACGCCGGAAGGTCGCTG
CCTGCAGTACACCTGCCAGGCACCCAAACAGGTGACTGCCTTGGGATGCC
CGGCCATCGCCTCCTTGAAGCCCTGCAAAATGGAAGAGGATCTGAGCAAA
CCCTATCCCGGCTGCTGTCCCAAGTTCAACTGCTGACAACGCCTCCCTCG
CAAGTCGAACTGCAAATGTGAAATGAACTATGAAAACTGAATATATAACT
ATAGAAACATACATACCTAAAAAAAAAAAAAAAA

RH08789.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:04:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG32667-RA 377 CG32667-RA 5..376 1..372 1845 99.7 Plus
nc_23059.a 2366 nc_23059.a 1881..1997 311..195 585 100 Minus
nc_23059.a 2366 nc_23059.a 2017..2118 187..86 510 100 Minus
nc_23059.a 2366 nc_23059.a 2186..2271 86..1 430 100 Minus
CG15202.b 707 CG15202.b 1..44 238..195 220 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:31:50
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 11031020..11031193 368..195 840 98.9 Minus
chrX 22417052 chrX 11031259..11031368 195..86 535 99.1 Minus
chrX 22417052 chrX 11031436..11031521 86..1 415 98.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:20:49 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:31:48
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 11139758..11139935 372..195 875 99.4 Minus
X 23542271 X 11140001..11140110 195..86 550 100 Minus
X 23542271 X 11140178..11140263 86..1 430 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:59:13
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 11147856..11148033 372..195 875 99.4 Minus
X 23527363 X 11148099..11148208 195..86 550 100 Minus
X 23527363 X 11148276..11148361 86..1 430 100 Minus
Blast to na_te.dros performed on 2019-03-16 09:31:49 has no hits.

RH08789.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:32:40 Download gff for RH08789.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 11031020..11031192 196..368 98 <- Minus
chrX 11031259..11031367 87..195 99 <- Minus
chrX 11031436..11031521 1..86 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:40:30 Download gff for RH08789.complete
Subject Subject Range Query Range Percent Splice Strand
CG32667-RA 1..267 20..286 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:03:19 Download gff for RH08789.complete
Subject Subject Range Query Range Percent Splice Strand
CG32667-RA 1..267 20..286 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:02:25 Download gff for RH08789.complete
Subject Subject Range Query Range Percent Splice Strand
CG32667-RA 1..267 20..286 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:03:50 Download gff for RH08789.complete
Subject Subject Range Query Range Percent Splice Strand
CG32667-RA 1..267 20..286 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:12:51 Download gff for RH08789.complete
Subject Subject Range Query Range Percent Splice Strand
ssp7-RA 1..267 20..286 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:28:52 Download gff for RH08789.complete
Subject Subject Range Query Range Percent Splice Strand
CG32667-RA 1..368 1..368 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:03:19 Download gff for RH08789.complete
Subject Subject Range Query Range Percent Splice Strand
CG32667-RA 1..368 1..368 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:02:25 Download gff for RH08789.complete
Subject Subject Range Query Range Percent Splice Strand
CG32667-RA 1..368 1..368 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:03:50 Download gff for RH08789.complete
Subject Subject Range Query Range Percent Splice Strand
CG32667-RA 1..368 1..368 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:12:51 Download gff for RH08789.complete
Subject Subject Range Query Range Percent Splice Strand
ssp7-RA 1..368 1..368 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:32:40 Download gff for RH08789.complete
Subject Subject Range Query Range Percent Splice Strand
X 11139762..11139934 196..368 100 <- Minus
X 11140001..11140109 87..195 100 <- Minus
X 11140178..11140263 1..86 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:32:40 Download gff for RH08789.complete
Subject Subject Range Query Range Percent Splice Strand
X 11139762..11139934 196..368 100 <- Minus
X 11140001..11140109 87..195 100 <- Minus
X 11140178..11140263 1..86 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:32:40 Download gff for RH08789.complete
Subject Subject Range Query Range Percent Splice Strand
X 11139762..11139934 196..368 100 <- Minus
X 11140001..11140109 87..195 100 <- Minus
X 11140178..11140263 1..86 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:02:25 Download gff for RH08789.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 11033795..11033967 196..368 100 <- Minus
arm_X 11034034..11034142 87..195 100 <- Minus
arm_X 11034211..11034296 1..86 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:37:40 Download gff for RH08789.complete
Subject Subject Range Query Range Percent Splice Strand
X 11147860..11148032 196..368 100 <- Minus
X 11148099..11148207 87..195 100 <- Minus
X 11148276..11148361 1..86 100   Minus

RH08789.hyp Sequence

Translation from 19 to 285

> RH08789.hyp
MKSVTFVLCLLVLGAHSLLVFAVDCEIGGHQFKTGEKYTPEGRCLQYTCQ
APKQVTALGCPAIASLKPCKMEEDLSKPYPGCCPKFNC*

RH08789.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:11:39
Subject Length Description Subject Range Query Range Score Percent Strand
ssp7-PA 88 CG32667-PA 1..88 1..88 488 100 Plus

RH08789.pep Sequence

Translation from 19 to 285

> RH08789.pep
MKSVTFVLCLLVLGAHSLLVFAVDCEIGGHQFKTGEKYTPEGRCLQYTCQ
APKQVTALGCPAIASLKPCKMEEDLSKPYPGCCPKFNC*

RH08789.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:08:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20393-PA 89 GF20393-PA 1..89 1..88 295 60.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:08:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18878-PA 88 GG18878-PA 1..88 1..88 412 88.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:08:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24575-PA 94 GH24575-PA 1..87 1..88 257 53.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:20:58
Subject Length Description Subject Range Query Range Score Percent Strand
ssp7-PA 88 CG32667-PA 1..88 1..88 488 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:08:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15280-PA 94 GI15280-PA 1..87 1..88 249 53.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:08:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20257-PA 90 GL20257-PA 1..90 1..88 230 51.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:08:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26998-PA 90 GA26998-PA 1..90 1..88 216 48.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:08:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11263-PA 88 GM11263-PA 1..88 1..88 443 95.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:08:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16000-PA 88 GD16000-PA 1..88 1..88 447 96.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:08:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16933-PA 93 GJ16933-PA 1..87 1..88 253 51.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:08:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17235-PA 88 GK17235-PA 1..88 1..88 316 64.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:08:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17318-PA 88 GE17318-PA 1..88 1..88 388 81.8 Plus