Clone RH08870 Report

Search the DGRC for RH08870

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:88
Well:70
Vector:pFlc-1
Associated Gene/TranscriptATPsyn-Cf6-RA
Protein status:RH08870.pep: gold
Preliminary Size:532
Sequenced Size:539

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4412 2002-10-13 Blastp of sequenced clone
CG4412 2003-01-01 Sim4 clustering to Release 3
ATPsyn-Cf6 2008-04-29 Release 5.5 accounting
ATPsyn-Cf6 2008-08-15 Release 5.9 accounting
ATPsyn-Cf6 2008-12-18 5.12 accounting

Clone Sequence Records

RH08870.complete Sequence

539 bp (539 high quality bases) assembled on 2002-10-13

GenBank Submission: BT001763

> RH08870.complete
GATCACTAACACCAACTGCCATTGTGAACTGACAATTGTAACTTTTCCGC
ACGAAAGTTAGCATTTGCAAAGGAAAATAAGATGCTGTCGCAATCCCTGC
TGAGTGGCATGCGTGTCCTGCGCACAGAGGCCCGTCGTAACTTCGGAATC
GTTGCCCCTGCCCTGAACAAGGCCTCCGATCCCATCCAGCAGCTGTTCCT
GGACAAAGTGCGCGAGTACAAGCAGAAGAGCGCCGGTGGCAAGCTGGTGG
ACTCCAATCCCGATATTGAGCGGGAGCTGAAGACCGAACTGGACCGTGTG
GCCAAGCAGTTTGGCAGCGATGGCAAGACCGACATGCTGAAGTTCCCCGA
ATTCCAGTTCCCCGATGTTAAGGTCGATCCCATCACCCAGGCCCCACAGT
AGAGATCGCTCTTCGCGAATGAGTTAGTCTAATTGCTTTAAGTTCAGCTG
CTGATTTCGCCTGTGCGCCCCCAAAAACCGCGGGCAAGTCAACAAAAAAA
ACCAATAAAATCGGGAAAACAACAAAAAAAAAAAAAAAA

RH08870.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:38:58
Subject Length Description Subject Range Query Range Score Percent Strand
ATPsyn-Cf6-RA 734 ATPsyn-Cf6-RA 79..602 2..525 2620 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:43:39
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 19178679..19178968 523..234 1420 99.3 Minus
chr3R 27901430 chr3R 19179033..19179186 233..80 770 100 Minus
chr3R 27901430 chr3R 19179380..19179459 81..2 400 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:20:52 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:43:37
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 23355278..23355569 525..234 1460 100 Minus
3R 32079331 3R 23355634..23355787 233..80 770 100 Minus
3R 32079331 3R 23355981..23356060 81..2 400 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:12:37
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 23096109..23096400 525..234 1460 100 Minus
3R 31820162 3R 23096465..23096618 233..80 770 100 Minus
3R 31820162 3R 23096812..23096891 81..2 400 100 Minus
Blast to na_te.dros performed on 2019-03-16 19:43:37 has no hits.

RH08870.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:44:20 Download gff for RH08870.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 19178679..19178968 234..523 99 <- Minus
chr3R 19179033..19179184 82..233 100 <- Minus
chr3R 19179380..19179459 1..81 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:40:32 Download gff for RH08870.complete
Subject Subject Range Query Range Percent Splice Strand
ATPsyn-Cf6-RA 1..321 82..402 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:10:56 Download gff for RH08870.complete
Subject Subject Range Query Range Percent Splice Strand
ATPsyn-Cf6-RA 1..321 82..402 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:33:48 Download gff for RH08870.complete
Subject Subject Range Query Range Percent Splice Strand
ATPsyn-Cf6-RA 1..321 82..402 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:01:47 Download gff for RH08870.complete
Subject Subject Range Query Range Percent Splice Strand
ATPsyn-Cf6-RA 1..321 82..402 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:41:29 Download gff for RH08870.complete
Subject Subject Range Query Range Percent Splice Strand
ATPsyn-Cf6-RA 1..321 82..402 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:32:27 Download gff for RH08870.complete
Subject Subject Range Query Range Percent Splice Strand
ATPsyn-Cf6-RA 1..522 2..523 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:10:56 Download gff for RH08870.complete
Subject Subject Range Query Range Percent Splice Strand
ATPsyn-Cf6-RA 1..522 2..523 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:33:48 Download gff for RH08870.complete
Subject Subject Range Query Range Percent Splice Strand
ATPsyn-Cf6-RA 4..526 1..523 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:01:47 Download gff for RH08870.complete
Subject Subject Range Query Range Percent Splice Strand
ATPsyn-Cf6-RA 1..522 2..523 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:41:29 Download gff for RH08870.complete
Subject Subject Range Query Range Percent Splice Strand
ATPsyn-Cf6-RA 4..526 1..523 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:44:20 Download gff for RH08870.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23355280..23355569 234..523 100 <- Minus
3R 23355634..23355785 82..233 100 <- Minus
3R 23355981..23356060 1..81 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:44:20 Download gff for RH08870.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23355280..23355569 234..523 100 <- Minus
3R 23355634..23355785 82..233 100 <- Minus
3R 23355981..23356060 1..81 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:44:20 Download gff for RH08870.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23355280..23355569 234..523 100 <- Minus
3R 23355634..23355785 82..233 100 <- Minus
3R 23355981..23356060 1..81 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:33:48 Download gff for RH08870.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 19181002..19181291 234..523 100 <- Minus
arm_3R 19181356..19181507 82..233 100 <- Minus
arm_3R 19181703..19181782 1..81 98   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:33:27 Download gff for RH08870.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23096111..23096400 234..523 100 <- Minus
3R 23096465..23096616 82..233 100 <- Minus
3R 23096812..23096891 1..81 98   Minus

RH08870.hyp Sequence

Translation from 81 to 401

> RH08870.hyp
MLSQSLLSGMRVLRTEARRNFGIVAPALNKASDPIQQLFLDKVREYKQKS
AGGKLVDSNPDIERELKTELDRVAKQFGSDGKTDMLKFPEFQFPDVKVDP
ITQAPQ*

RH08870.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:41:02
Subject Length Description Subject Range Query Range Score Percent Strand
ATPsyn-Cf6-PB 106 CG4412-PB 1..106 1..106 534 100 Plus
ATPsyn-Cf6-PC 106 CG4412-PC 1..106 1..106 534 100 Plus
ATPsyn-Cf6-PA 106 CG4412-PA 1..106 1..106 534 100 Plus
CG12027-PA 147 CG12027-PA 26..95 33..102 203 54.3 Plus

RH08870.pep Sequence

Translation from 81 to 401

> RH08870.pep
MLSQSLLSGMRVLRTEARRNFGIVAPALNKASDPIQQLFLDKVREYKQKS
AGGKLVDSNPDIERELKTELDRVAKQFGSDGKTDMLKFPEFQFPDVKVDP
ITQAPQ*

RH08870.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 03:15:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18010-PA 106 GF18010-PA 1..103 1..103 471 86.4 Plus
Dana\GF24705-PA 153 GF24705-PA 13..94 18..102 154 36.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 03:15:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12440-PA 106 GG12440-PA 1..106 1..106 545 100 Plus
Dere\GG14149-PA 147 GG14149-PA 1..95 1..102 207 43.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 03:15:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18020-PA 106 GH18020-PA 1..104 1..104 476 84.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:44:10
Subject Length Description Subject Range Query Range Score Percent Strand
ATPsynCF6-PB 106 CG4412-PB 1..106 1..106 534 100 Plus
ATPsynCF6-PC 106 CG4412-PC 1..106 1..106 534 100 Plus
ATPsynCF6-PA 106 CG4412-PA 1..106 1..106 534 100 Plus
ATPsynCF6L-PA 147 CG12027-PA 26..95 33..102 203 54.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 03:15:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23616-PA 106 GI23616-PA 1..104 1..104 478 84.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 03:15:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13700-PA 106 GL13700-PA 1..104 1..104 482 86.5 Plus
Dper\GL13184-PA 99 GL13184-PA 13..96 17..102 174 39.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 03:15:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18167-PA 106 GA18167-PA 1..104 1..104 482 86.5 Plus
Dpse\GA11349-PA 180 GA11349-PA 13..96 17..102 176 39.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 03:15:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23571-PA 106 GM23571-PA 1..106 1..106 541 99.1 Plus
Dsec\GM13936-PA 147 GM13936-PA 20..95 27..102 201 51.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 03:15:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18388-PA 106 GD18388-PA 1..106 1..106 541 99.1 Plus
Dsim\GD13216-PA 147 GD13216-PA 4..95 11..102 206 44.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 03:15:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23589-PA 106 GJ23589-PA 1..104 1..104 486 86.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 03:15:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12240-PA 106 GK12240-PA 1..104 1..104 473 84.6 Plus
Dwil\GK17585-PA 153 GK17585-PA 17..97 22..102 181 43.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 03:15:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23963-PA 106 GE23963-PA 1..106 1..106 535 98.1 Plus
Dyak\GE20577-PA 147 GE20577-PA 4..95 11..102 198 42.4 Plus