Clone RH08962 Report

Search the DGRC for RH08962

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:89
Well:62
Vector:pFlc-1
Associated Gene/TranscriptRpS30-RA
Protein status:RH08962.pep: gold
Preliminary Size:574
Sequenced Size:547

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15697 2002-01-01 Sim4 clustering to Release 2
CG15697 2002-06-11 Blastp of sequenced clone
RpS30 2008-04-29 Release 5.5 accounting
RpS30 2008-08-15 Release 5.9 accounting
RpS30 2008-12-18 5.12 accounting

Clone Sequence Records

RH08962.complete Sequence

547 bp (547 high quality bases) assembled on 2002-06-11

GenBank Submission: AY071683

> RH08962.complete
GCTTTCTTTTTCGGGATCCGCACACCAAGTTAAGAGAGCGAATCATCATG
CAGCTGTTCGTCCGTGGACTAGAGACCATCGAGGCCCTGGAGGTTTCCCA
GGATGCCACCATTGCCGGAGTCAAGAACCAACTGGCCCAGATCCATGGAT
TCAACGCCGAGGAATTCAGCCTCGATTGCGAGGGCATCACTCTGGCCAAC
GAGACTCCCGTGACCGCCCTGAGCTCCTTTGAGCTGGACCTCAACATTCC
CATGCTGGGAGGTAAGGTGCACGGTTCTCTGGCCCGTGCCGGCAAGGTCA
AGGGACAGACGCCCAAGGTGGAGAAGCAGGAGAAGAAGAAGAAGAAGACC
GGACGCGCCAAGCGCAGGATCCAGTACAACCGCCGGTTCGTCAACTTTGT
GCAGGGCTTCGGCCGTCGTCGCGGCCCCAACGCCAACTCCACATAGAAGG
ATTTTGGATGAACAAGTGTCTACCTTTTACTCCAGATTGATATGATTGTT
CATAAAGTAATTTCAAACCTTTAAAAAAAAGAAAAAAAAAAAAAAAA

RH08962.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:26:57
Subject Length Description Subject Range Query Range Score Percent Strand
RpS30.b 939 RpS30.b 110..637 2..529 2625 99.8 Plus
RpS30-RA 944 RpS30-RA 115..642 2..529 2625 99.8 Plus
RpS30.c 770 RpS30.c 255..749 35..529 2460 99.7 Plus
RpS30.c 770 RpS30.c 1..29 8..36 145 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:46:21
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 16674908..16675313 124..529 2015 99.8 Plus
chr3R 27901430 chr3R 16674732..16674822 35..125 455 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:20:54 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:46:20
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 20851029..20851434 124..529 2015 99.8 Plus
3R 32079331 3R 20850853..20850943 35..125 455 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:18:21
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 20591860..20592265 124..529 2015 99.7 Plus
3R 31820162 3R 20591684..20591774 35..125 455 100 Plus
3R 31820162 3R 20591424..20591458 2..36 175 100 Plus
Blast to na_te.dros performed on 2019-03-16 19:46:20 has no hits.

RH08962.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:47:28 Download gff for RH08962.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 16674471..16674506 1..36 97 -> Plus
chr3R 16674734..16674822 37..125 100 -> Plus
chr3R 16674910..16675315 126..531 92   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:40:35 Download gff for RH08962.complete
Subject Subject Range Query Range Percent Splice Strand
RpS30-RB 1..399 48..446 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:48:13 Download gff for RH08962.complete
Subject Subject Range Query Range Percent Splice Strand
RpS30-RB 1..399 48..446 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:33:52 Download gff for RH08962.complete
Subject Subject Range Query Range Percent Splice Strand
RpS30-RA 1..399 48..446 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:29:29 Download gff for RH08962.complete
Subject Subject Range Query Range Percent Splice Strand
RpS30-RB 1..399 48..446 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:41:48 Download gff for RH08962.complete
Subject Subject Range Query Range Percent Splice Strand
RpS30-RA 1..399 48..446 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:21:25 Download gff for RH08962.complete
Subject Subject Range Query Range Percent Splice Strand
RpS30-RA 44..572 1..529 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:48:13 Download gff for RH08962.complete
Subject Subject Range Query Range Percent Splice Strand
RpS30-RA 44..572 1..529 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:33:52 Download gff for RH08962.complete
Subject Subject Range Query Range Percent Splice Strand
RpS30-RA 2..523 1..522 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:29:29 Download gff for RH08962.complete
Subject Subject Range Query Range Percent Splice Strand
RpS30-RA 44..572 1..529 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:41:48 Download gff for RH08962.complete
Subject Subject Range Query Range Percent Splice Strand
RpS30-RC 77..598 1..522 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:47:28 Download gff for RH08962.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20850592..20850627 1..36 97 -> Plus
3R 20850855..20850943 37..125 100 -> Plus
3R 20851031..20851436 126..531 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:47:28 Download gff for RH08962.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20850592..20850627 1..36 97 -> Plus
3R 20850855..20850943 37..125 100 -> Plus
3R 20851031..20851436 126..531 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:47:28 Download gff for RH08962.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20850592..20850627 1..36 97 -> Plus
3R 20850855..20850943 37..125 100 -> Plus
3R 20851031..20851436 126..531 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:33:52 Download gff for RH08962.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 16676314..16676349 1..36 97 -> Plus
arm_3R 16676577..16676665 37..125 100 -> Plus
arm_3R 16676753..16677158 126..531 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:07:54 Download gff for RH08962.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20591862..20592267 126..531 99   Plus
3R 20591423..20591458 1..36 97 -> Plus
3R 20591686..20591774 37..125 100 -> Plus

RH08962.hyp Sequence

Translation from 2 to 445

> RH08962.hyp
FLFRDPHTKLRERIIMQLFVRGLETIEALEVSQDATIAGVKNQLAQIHGF
NAEEFSLDCEGITLANETPVTALSSFELDLNIPMLGGKVHGSLARAGKVK
GQTPKVEKQEKKKKKTGRAKRRIQYNRRFVNFVQGFGRRRGPNANST*

RH08962.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:32:31
Subject Length Description Subject Range Query Range Score Percent Strand
RpS30-PC 132 CG15697-PC 1..132 16..147 668 100 Plus
RpS30-PB 132 CG15697-PB 1..132 16..147 668 100 Plus
RpS30-PA 132 CG15697-PA 1..132 16..147 668 100 Plus

RH08962.pep Sequence

Translation from 47 to 445

> RH08962.pep
MQLFVRGLETIEALEVSQDATIAGVKNQLAQIHGFNAEEFSLDCEGITLA
NETPVTALSSFELDLNIPMLGGKVHGSLARAGKVKGQTPKVEKQEKKKKK
TGRAKRRIQYNRRFVNFVQGFGRRRGPNANST*

RH08962.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:46:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17995-PA 132 GF17995-PA 1..132 1..132 590 93.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:46:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24199-PA 132 GG24199-PA 1..132 1..132 663 96.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 13:46:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15894-PA 132 GH15894-PA 1..132 1..132 565 88.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:15:37
Subject Length Description Subject Range Query Range Score Percent Strand
RpS30-PC 132 CG15697-PC 1..132 1..132 668 100 Plus
RpS30-PB 132 CG15697-PB 1..132 1..132 668 100 Plus
RpS30-PA 132 CG15697-PA 1..132 1..132 668 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 13:46:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10603-PA 132 GI10603-PA 1..132 1..132 570 90.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:46:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24284-PA 132 GL24284-PA 1..132 1..132 603 95.5 Plus
Dper\GL10054-PA 132 GL10054-PA 1..132 1..132 603 95.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:46:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13897-PA 132 GA13897-PA 1..132 1..132 594 94.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:46:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23141-PA 132 GM23141-PA 1..132 1..132 685 99.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:46:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19380-PA 132 GD19380-PA 1..132 1..132 685 99.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 13:46:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22957-PA 132 GJ22957-PA 1..132 1..132 583 90.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 13:46:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16891-PA 132 GK16891-PA 1..132 1..132 542 86.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:46:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25693-PA 132 GE25693-PA 1..132 1..132 682 98.5 Plus
Dyak\GE11221-PA 64 GE11221-PA 1..64 69..132 315 98.4 Plus