BDGP Sequence Production Resources |
Search the DGRC for RH08962
Library: | RH |
Tissue Source: | Drosophila melanogaster adult head |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2001-04-30 |
Comments: | Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 89 |
Well: | 62 |
Vector: | pFlc-1 |
Associated Gene/Transcript | RpS30-RA |
Protein status: | RH08962.pep: gold |
Preliminary Size: | 574 |
Sequenced Size: | 547 |
Gene | Date | Evidence |
---|---|---|
CG15697 | 2002-01-01 | Sim4 clustering to Release 2 |
CG15697 | 2002-06-11 | Blastp of sequenced clone |
RpS30 | 2008-04-29 | Release 5.5 accounting |
RpS30 | 2008-08-15 | Release 5.9 accounting |
RpS30 | 2008-12-18 | 5.12 accounting |
547 bp (547 high quality bases) assembled on 2002-06-11
GenBank Submission: AY071683
> RH08962.complete GCTTTCTTTTTCGGGATCCGCACACCAAGTTAAGAGAGCGAATCATCATG CAGCTGTTCGTCCGTGGACTAGAGACCATCGAGGCCCTGGAGGTTTCCCA GGATGCCACCATTGCCGGAGTCAAGAACCAACTGGCCCAGATCCATGGAT TCAACGCCGAGGAATTCAGCCTCGATTGCGAGGGCATCACTCTGGCCAAC GAGACTCCCGTGACCGCCCTGAGCTCCTTTGAGCTGGACCTCAACATTCC CATGCTGGGAGGTAAGGTGCACGGTTCTCTGGCCCGTGCCGGCAAGGTCA AGGGACAGACGCCCAAGGTGGAGAAGCAGGAGAAGAAGAAGAAGAAGACC GGACGCGCCAAGCGCAGGATCCAGTACAACCGCCGGTTCGTCAACTTTGT GCAGGGCTTCGGCCGTCGTCGCGGCCCCAACGCCAACTCCACATAGAAGG ATTTTGGATGAACAAGTGTCTACCTTTTACTCCAGATTGATATGATTGTT CATAAAGTAATTTCAAACCTTTAAAAAAAAGAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpS30.b | 939 | RpS30.b | 110..637 | 2..529 | 2625 | 99.8 | Plus |
RpS30-RA | 944 | RpS30-RA | 115..642 | 2..529 | 2625 | 99.8 | Plus |
RpS30.c | 770 | RpS30.c | 255..749 | 35..529 | 2460 | 99.7 | Plus |
RpS30.c | 770 | RpS30.c | 1..29 | 8..36 | 145 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 20591860..20592265 | 124..529 | 2015 | 99.7 | Plus |
3R | 31820162 | 3R | 20591684..20591774 | 35..125 | 455 | 100 | Plus |
3R | 31820162 | 3R | 20591424..20591458 | 2..36 | 175 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 16674471..16674506 | 1..36 | 97 | -> | Plus |
chr3R | 16674734..16674822 | 37..125 | 100 | -> | Plus |
chr3R | 16674910..16675315 | 126..531 | 92 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS30-RB | 1..399 | 48..446 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS30-RB | 1..399 | 48..446 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS30-RA | 1..399 | 48..446 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS30-RB | 1..399 | 48..446 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS30-RA | 1..399 | 48..446 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS30-RA | 44..572 | 1..529 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS30-RA | 44..572 | 1..529 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS30-RA | 2..523 | 1..522 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS30-RA | 44..572 | 1..529 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS30-RC | 77..598 | 1..522 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 20850592..20850627 | 1..36 | 97 | -> | Plus |
3R | 20850855..20850943 | 37..125 | 100 | -> | Plus |
3R | 20851031..20851436 | 126..531 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 20850592..20850627 | 1..36 | 97 | -> | Plus |
3R | 20850855..20850943 | 37..125 | 100 | -> | Plus |
3R | 20851031..20851436 | 126..531 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 20850592..20850627 | 1..36 | 97 | -> | Plus |
3R | 20850855..20850943 | 37..125 | 100 | -> | Plus |
3R | 20851031..20851436 | 126..531 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 16676314..16676349 | 1..36 | 97 | -> | Plus |
arm_3R | 16676577..16676665 | 37..125 | 100 | -> | Plus |
arm_3R | 16676753..16677158 | 126..531 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 20591862..20592267 | 126..531 | 99 | Plus | |
3R | 20591423..20591458 | 1..36 | 97 | -> | Plus |
3R | 20591686..20591774 | 37..125 | 100 | -> | Plus |
Translation from 2 to 445
> RH08962.hyp FLFRDPHTKLRERIIMQLFVRGLETIEALEVSQDATIAGVKNQLAQIHGF NAEEFSLDCEGITLANETPVTALSSFELDLNIPMLGGKVHGSLARAGKVK GQTPKVEKQEKKKKKTGRAKRRIQYNRRFVNFVQGFGRRRGPNANST*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpS30-PC | 132 | CG15697-PC | 1..132 | 16..147 | 668 | 100 | Plus |
RpS30-PB | 132 | CG15697-PB | 1..132 | 16..147 | 668 | 100 | Plus |
RpS30-PA | 132 | CG15697-PA | 1..132 | 16..147 | 668 | 100 | Plus |
Translation from 47 to 445
> RH08962.pep MQLFVRGLETIEALEVSQDATIAGVKNQLAQIHGFNAEEFSLDCEGITLA NETPVTALSSFELDLNIPMLGGKVHGSLARAGKVKGQTPKVEKQEKKKKK TGRAKRRIQYNRRFVNFVQGFGRRRGPNANST*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF17995-PA | 132 | GF17995-PA | 1..132 | 1..132 | 590 | 93.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG24199-PA | 132 | GG24199-PA | 1..132 | 1..132 | 663 | 96.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH15894-PA | 132 | GH15894-PA | 1..132 | 1..132 | 565 | 88.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpS30-PC | 132 | CG15697-PC | 1..132 | 1..132 | 668 | 100 | Plus |
RpS30-PB | 132 | CG15697-PB | 1..132 | 1..132 | 668 | 100 | Plus |
RpS30-PA | 132 | CG15697-PA | 1..132 | 1..132 | 668 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI10603-PA | 132 | GI10603-PA | 1..132 | 1..132 | 570 | 90.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL24284-PA | 132 | GL24284-PA | 1..132 | 1..132 | 603 | 95.5 | Plus |
Dper\GL10054-PA | 132 | GL10054-PA | 1..132 | 1..132 | 603 | 95.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA13897-PA | 132 | GA13897-PA | 1..132 | 1..132 | 594 | 94.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM23141-PA | 132 | GM23141-PA | 1..132 | 1..132 | 685 | 99.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD19380-PA | 132 | GD19380-PA | 1..132 | 1..132 | 685 | 99.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ22957-PA | 132 | GJ22957-PA | 1..132 | 1..132 | 583 | 90.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK16891-PA | 132 | GK16891-PA | 1..132 | 1..132 | 542 | 86.4 | Plus |