Clone RH09070 Report

Search the DGRC for RH09070

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:90
Well:70
Vector:pFlc-1
Associated Gene/TranscriptCG3603-RA
Protein status:RH09070.pep: gold
Preliminary Size:588
Sequenced Size:860

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3603 2002-01-01 Sim4 clustering to Release 2
CG3603 2002-04-21 Blastp of sequenced clone
CG3603 2003-01-01 Sim4 clustering to Release 3
CG3603 2008-04-29 Release 5.5 accounting
CG3603 2008-08-15 Release 5.9 accounting
CG3603 2008-12-18 5.12 accounting

Clone Sequence Records

RH09070.complete Sequence

860 bp (860 high quality bases) assembled on 2002-04-21

GenBank Submission: AY113563

> RH09070.complete
GATAGTTGTCGCACGACCGTTGAGGAGAAAACAAGTGAAAACTGCTGTTT
ACTAAGTCATTTTTAGAGCCATGTCAGTGGGAGTACTAGCTGGAAAAGTA
GCCCTGGTAACAGGTGCCGGATCAGGAATTGGTCGTGCCACCTGCCGCCT
TTTGGCCAGAGATGGTGCCAAAGTGATCGCCGTTGACCGCAATCTAAAGG
CGGCCCAAGAAACCGTACAGGAATTGGGCTCTGAGCGATCTGCCGCCCTG
GAGGTGGACGTTTCCTCTGCCCAGAGTGTTCAATTCTCGGTGGCCGAGGC
CCTAAAGAAATTCCAGCAGGCACCCACTATTGTGGTCAATTCGGCTGGAA
TAACCCGAGATGGTTATCTGCTCAAGATGCCCGAACGGGACTACGATGAC
GTATACGGGGTCAATCTGAAGGGCACCTTTCTGGTTACCCAGGCCTATGC
CAAGGCCATGATCGAGCAGAAACTGGAAAACGGCACCATTGTGAACCTCT
CAAGCATCGTGGCCAAGATGAACAACGTGGGCCAGGCCAACTATGCGGCC
ACCAAGGCGGGCGTGATCTCCTTCACGGAGGTGGCCTCCAAGGAGTTCGG
AAAGTTTGGCATCCGTGTGAACTGCATCCTGCCAGGCTACATAGACACGC
CCATGGTAGCGGTTGTGCCCGATTCTGTAAAGCAGGAGGTGGTACAACGA
TGCCCCTTGGGCCGATTGGGTCAGCCGGAGGAGATCGCCGAGGTCATTGC
CTTTTTGGCCTCCCCGCAATCGTCATACGTCAATGGGGCTGCCATCGAGG
TCACCGGGGGCCTTAAATAATCGTGAAATGCATATATGCAATATAAAAAA
AAAAAAAAAA

RH09070.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:52:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG3603.a 1581 CG3603.a 120..964 2..846 4225 100 Plus
CG3603-RA 1166 CG3603-RA 120..964 2..846 4225 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 23:43:15
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 2842013..2842745 112..844 3560 99 Plus
chrX 22417052 chrX 2841834..2841948 2..116 545 98.3 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:20:57 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 23:43:13
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 2948216..2948950 112..846 3675 100 Plus
X 23542271 X 2948037..2948151 2..116 575 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:24:42
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 2956314..2957048 112..846 3675 100 Plus
X 23527363 X 2956135..2956249 2..116 575 100 Plus
Blast to na_te.dros performed on 2019-03-16 23:43:14 has no hits.

RH09070.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 23:44:16 Download gff for RH09070.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 2841833..2841945 1..113 97 -> Plus
chrX 2842015..2842745 114..844 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:40:39 Download gff for RH09070.complete
Subject Subject Range Query Range Percent Splice Strand
CG3603-RA 1..750 71..820 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:28:48 Download gff for RH09070.complete
Subject Subject Range Query Range Percent Splice Strand
CG3603-RA 1..750 71..820 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:23:13 Download gff for RH09070.complete
Subject Subject Range Query Range Percent Splice Strand
CG3603-RA 1..750 71..820 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:19:08 Download gff for RH09070.complete
Subject Subject Range Query Range Percent Splice Strand
CG3603-RA 1..750 71..820 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:56:40 Download gff for RH09070.complete
Subject Subject Range Query Range Percent Splice Strand
CG3603-RA 1..750 71..820 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:57:48 Download gff for RH09070.complete
Subject Subject Range Query Range Percent Splice Strand
CG3603-RA 2..844 2..844 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:28:48 Download gff for RH09070.complete
Subject Subject Range Query Range Percent Splice Strand
CG3603-RA 2..845 1..844 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:23:13 Download gff for RH09070.complete
Subject Subject Range Query Range Percent Splice Strand
CG3603-RA 3..846 1..844 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:19:08 Download gff for RH09070.complete
Subject Subject Range Query Range Percent Splice Strand
CG3603-RA 2..844 2..844 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:56:40 Download gff for RH09070.complete
Subject Subject Range Query Range Percent Splice Strand
CG3603-RA 3..846 1..844 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:44:16 Download gff for RH09070.complete
Subject Subject Range Query Range Percent Splice Strand
X 2948036..2948148 1..113 99 -> Plus
X 2948218..2948948 114..844 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:44:16 Download gff for RH09070.complete
Subject Subject Range Query Range Percent Splice Strand
X 2948036..2948148 1..113 99 -> Plus
X 2948218..2948948 114..844 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:44:16 Download gff for RH09070.complete
Subject Subject Range Query Range Percent Splice Strand
X 2948036..2948148 1..113 99 -> Plus
X 2948218..2948948 114..844 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:23:13 Download gff for RH09070.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 2842069..2842181 1..113 99 -> Plus
arm_X 2842251..2842981 114..844 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:52:39 Download gff for RH09070.complete
Subject Subject Range Query Range Percent Splice Strand
X 2956316..2957046 114..844 100   Plus
X 2956134..2956246 1..113 99 -> Plus

RH09070.pep Sequence

Translation from 70 to 819

> RH09070.pep
MSVGVLAGKVALVTGAGSGIGRATCRLLARDGAKVIAVDRNLKAAQETVQ
ELGSERSAALEVDVSSAQSVQFSVAEALKKFQQAPTIVVNSAGITRDGYL
LKMPERDYDDVYGVNLKGTFLVTQAYAKAMIEQKLENGTIVNLSSIVAKM
NNVGQANYAATKAGVISFTEVASKEFGKFGIRVNCILPGYIDTPMVAVVP
DSVKQEVVQRCPLGRLGQPEEIAEVIAFLASPQSSYVNGAAIEVTGGLK*

RH09070.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 06:52:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22468-PA 249 GF22468-PA 1..248 1..248 1141 85.5 Plus
Dana\GF22046-PA 251 GF22046-PA 3..244 6..247 322 34.5 Plus
Dana\GF19246-PA 242 GF19246-PA 3..238 4..247 299 35.5 Plus
Dana\GF10473-PA 318 GF10473-PA 70..314 6..248 299 34.4 Plus
Dana\GF19368-PA 255 GF19368-PA 1..252 5..249 282 32.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 06:52:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18643-PA 249 GG18643-PA 1..249 1..249 1266 98 Plus
Dere\GG12728-PA 251 GG12728-PA 3..244 6..247 321 33.5 Plus
Dere\GG14143-PA 317 GG14143-PA 69..313 6..248 302 32.8 Plus
Dere\GG19147-PA 255 GG19147-PA 6..252 10..249 292 33.9 Plus
Dere\GG18088-PA 242 GG18088-PA 5..238 6..247 264 36.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 06:52:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12482-PA 248 GH12482-PA 1..248 1..249 1091 83.5 Plus
Dgri\GH17658-PA 242 GH17658-PA 5..238 6..247 292 37.1 Plus
Dgri\GH15276-PA 325 GH15276-PA 77..321 6..248 273 30 Plus
Dgri\GH24783-PA 255 GH24783-PA 1..252 5..249 271 32.4 Plus
Dgri\GH22984-PA 257 GH22984-PA 7..250 9..247 264 33.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:26:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG3603-PB 249 CG3603-PB 1..249 1..249 1224 100 Plus
CG3603-PA 249 CG3603-PA 1..249 1..249 1224 100 Plus
CG3699-PA 251 CG3699-PA 3..244 6..247 341 33.1 Plus
CG10672-PA 317 CG10672-PA 69..313 6..248 311 32.8 Plus
scu-PA 255 CG7113-PA 1..252 5..249 302 33.2 Plus
CG7322-PC 242 CG7322-PC 5..238 6..247 290 35.4 Plus
CG7322-PB 242 CG7322-PB 5..238 6..247 290 35.4 Plus
CG7322-PA 242 CG7322-PA 5..238 6..247 290 35.4 Plus
CG12171-PA 257 CG12171-PA 7..250 9..247 277 32.8 Plus
CG31548-PA 256 CG31548-PA 4..249 7..247 272 32.8 Plus
CG31549-PB 257 CG31549-PB 7..250 9..247 266 31 Plus
CG31549-PA 257 CG31549-PA 7..250 9..247 266 31 Plus
CG31546-PA 264 CG31546-PA 12..257 7..247 255 29.2 Plus
Mfe2-PB 598 CG3415-PB 12..245 8..247 254 33.3 Plus
Mfe2-PA 598 CG3415-PA 12..245 8..247 254 33.3 Plus
antdh-PA 250 CG1386-PA 7..247 9..246 211 29.5 Plus
CG9265-PD 399 CG9265-PD 88..314 10..229 208 28.1 Plus
CG9265-PC 399 CG9265-PC 88..314 10..229 208 28.1 Plus
CG9265-PB 399 CG9265-PB 88..314 10..229 208 28.1 Plus
CG9265-PA 399 CG9265-PA 88..314 10..229 208 28.1 Plus
CG17121-PA 361 CG17121-PA 90..254 6..170 194 33.3 Plus
CG2065-PB 300 CG2065-PB 14..212 8..195 192 28.4 Plus
CG2065-PA 300 CG2065-PA 14..212 8..195 192 28.4 Plus
CG40485-PC 247 CG40485-PC 8..244 10..246 189 29.5 Plus
CG40485-PB 247 CG40485-PB 8..244 10..246 189 29.5 Plus
CG30491-PB 331 CG30491-PB 45..244 8..196 186 30.2 Plus
CG30491-PA 331 CG30491-PA 45..244 8..196 186 30.2 Plus
spidey-PA 321 CG1444-PA 52..268 8..217 185 26.7 Plus
CG13833-PA 321 CG13833-PA 50..240 6..193 183 27.8 Plus
CG15629-PA 325 CG15629-PA 54..250 6..199 183 27.5 Plus
CG2064-PA 330 CG2064-PA 43..241 8..195 183 28 Plus
scu-PB 126 CG7113-PB 11..123 136..249 181 34.8 Plus
CG31809-PC 316 CG31809-PC 48..244 8..205 173 29.2 Plus
CG31809-PB 316 CG31809-PB 48..244 8..205 173 29.2 Plus
CG31810-PA 324 CG31810-PA 56..252 8..205 173 29.2 Plus
CG2070-PB 325 CG2070-PB 43..246 8..200 172 27.8 Plus
CG2070-PA 325 CG2070-PA 43..246 8..200 172 27.8 Plus
CG40486-PC 247 CG40486-PC 7..204 9..196 170 30.5 Plus
CG40486-PB 247 CG40486-PB 7..204 9..196 170 30.5 Plus
CG3301-PC 250 CG3301-PC 7..200 9..193 170 29.1 Plus
CG3301-PB 250 CG3301-PB 7..200 9..193 170 29.1 Plus
CG3301-PA 250 CG3301-PA 7..200 9..193 170 29.1 Plus
CG7601-PA 326 CG7601-PA 51..243 6..195 170 27.6 Plus
CG7675-PE 287 CG7675-PE 1..269 6..249 165 26.3 Plus
CG7675-PC 287 CG7675-PC 1..269 6..249 165 26.3 Plus
CG7675-PA 287 CG7675-PA 1..269 6..249 165 26.3 Plus
Ldsdh1-PA 320 CG2254-PA 58..246 8..193 165 28.1 Plus
CG7675-PD 336 CG7675-PD 50..318 6..249 165 26.3 Plus
CG7675-PB 336 CG7675-PB 50..318 6..249 165 26.3 Plus
CG40485-PA 231 CG40485-PA 8..189 10..183 164 31 Plus
Pdh-PC 261 CG4899-PC 5..189 8..195 154 31.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 06:52:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11166-PA 249 GI11166-PA 1..249 1..249 1074 85.5 Plus
Dmoj\GI14997-PA 255 GI14997-PA 3..248 6..247 306 32.5 Plus
Dmoj\GI14682-PA 255 GI14682-PA 6..252 10..249 291 33.9 Plus
Dmoj\GI11985-PA 329 GI11985-PA 81..325 6..248 290 32.3 Plus
Dmoj\GI21510-PA 242 GI21510-PA 5..238 6..247 283 35.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 06:52:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19942-PA 295 GL19942-PA 1..163 1..163 705 84 Plus
Dper\GL14417-PA 255 GL14417-PA 3..248 6..247 305 32.9 Plus
Dper\GL21318-PA 350 GL21318-PA 113..346 6..247 282 36.4 Plus
Dper\GL23021-PA 256 GL23021-PA 3..249 6..247 262 32.7 Plus
Dper\GL14944-PA 255 GL14944-PA 6..252 10..249 259 33.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 06:52:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17551-PB 242 GA17551-PB 1..241 1..241 1085 85.5 Plus
Dpse\GA17622-PA 255 GA17622-PA 3..248 6..247 305 32.9 Plus
Dpse\GA10483-PA 319 GA10483-PA 71..315 6..248 289 32.4 Plus
Dpse\GA20258-PA 242 GA20258-PA 5..238 6..247 282 36.4 Plus
Dpse\GA16317-PA 256 GA16317-PA 3..249 6..247 263 32.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 06:52:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19262-PA 249 GM19262-PA 1..249 1..249 1268 98.8 Plus
Dsec\GM19006-PA 251 GM19006-PA 3..244 6..247 318 33.1 Plus
Dsec\GM13930-PA 317 GM13930-PA 69..313 6..248 302 32.8 Plus
Dsec\GM22877-PA 255 GM22877-PA 6..252 10..249 293 33.9 Plus
Dsec\GM22780-PA 242 GM22780-PA 5..238 6..247 291 36.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 06:52:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16628-PA 249 GD16628-PA 1..249 1..249 1274 99.2 Plus
Dsim\GD16445-PA 251 GD16445-PA 3..244 6..247 318 33.1 Plus
Dsim\GD24467-PA 242 GD24467-PA 5..238 6..247 297 36.8 Plus
Dsim\GD19595-PA 256 GD19595-PA 3..249 6..247 259 33.1 Plus
Dsim\GD19803-PA 257 GD19803-PA 7..250 9..247 249 32 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 06:52:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15296-PA 249 GJ15296-PA 1..249 1..249 1130 85.5 Plus
Dvir\GJ15354-PA 255 GJ15354-PA 3..248 6..247 328 34 Plus
Dvir\GJ12209-PA 328 GJ12209-PA 80..324 6..248 289 31.6 Plus
Dvir\GJ19048-PA 242 GJ19048-PA 8..238 9..247 287 37.2 Plus
Dvir\GJ16589-PA 255 GJ16589-PA 1..252 5..249 286 32.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 06:52:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25534-PA 248 GK25534-PA 1..248 1..249 1008 76 Plus
Dwil\GK10169-PA 255 GK10169-PA 3..248 6..247 316 35.3 Plus
Dwil\GK20088-PA 242 GK20088-PA 5..238 6..247 301 37.1 Plus
Dwil\GK25326-PA 255 GK25326-PA 6..252 10..249 294 34.7 Plus
Dwil\GK20583-PA 295 GK20583-PA 63..291 6..248 267 30.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 06:52:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16292-PA 249 GE16292-PA 1..249 1..249 1261 98 Plus
Dyak\GE16554-PA 251 GE16554-PA 3..244 6..247 322 33.5 Plus
Dyak\GE20571-PA 252 GE20571-PA 4..248 6..248 299 32.8 Plus
Dyak\GE15485-PA 242 GE15485-PA 5..238 6..247 298 37.2 Plus
Dyak\GE17707-PA 255 GE17707-PA 6..252 10..249 292 33.9 Plus

RH09070.hyp Sequence

Translation from 70 to 819

> RH09070.hyp
MSVGVLAGKVALVTGAGSGIGRATCRLLARDGAKVIAVDRNLKAAQETVQ
ELGSERSAALEVDVSSAQSVQFSVAEALKKFQQAPTIVVNSAGITRDGYL
LKMPERDYDDVYGVNLKGTFLVTQAYAKAMIEQKLENGTIVNLSSIVAKM
NNVGQANYAATKAGVISFTEVASKEFGKFGIRVNCILPGYIDTPMVAVVP
DSVKQEVVQRCPLGRLGQPEEIAEVIAFLASPQSSYVNGAAIEVTGGLK*

RH09070.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:20:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG3603-PB 249 CG3603-PB 1..249 1..249 1224 100 Plus
CG3603-PA 249 CG3603-PA 1..249 1..249 1224 100 Plus
CG3699-PA 251 CG3699-PA 3..244 6..247 341 33.1 Plus
CG10672-PA 317 CG10672-PA 69..313 6..248 311 32.8 Plus
scu-PA 255 CG7113-PA 1..252 5..249 302 33.2 Plus