Clone RH09147 Report

Search the DGRC for RH09147

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:91
Well:47
Vector:pFlc-1
Associated Gene/TranscriptCG18107-RA
Protein status:RH09147.pep: validated not full length
Sequenced Size:298

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG18107 2001-11-30 Blastp of sequenced clone
CG18107 2002-01-01 Sim4 clustering to Release 2
CG18107 2008-04-29 Release 5.5 accounting
CG18107 2008-08-15 Release 5.9 accounting
CG18107 2008-12-18 5.12 accounting

Clone Sequence Records

RH09147.complete Sequence

298 bp assembled on 2007-04-18

GenBank Submission: AY071684

> RH09147.complete
GATCAGTTGTAGTTGATCGTTTGTCCGGTGTGTTCAGCTTATAAAACCGG
ATCTATTAATTGAAAATCAATATGCGATTCTTTGCAATCGTCACTGTCTT
TGTGCTTGGTCTTCTGGCTTTGGCCAATGCTATTCCGTTGTCACCCGATC
CAGGAAATGTTATCATCAATGGCGACTGTGTGAATTGCAATGTTCGTGGT
GGCAAATAGAAATTTTTAATCAAAACTTATATTTAGCATCATAATAAAAA
TGTAATAAAATGAAAGCTATATTGTAAATTGCAAAAAAAAAAAAAAAA

RH09147.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:05:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG18107-RA 283 CG18107-RA 3..282 2..281 1400 100 Plus
CG15067-RA 871 CG15067-RA 785..871 281..195 435 100 Minus
IM1-RA 524 IM1-RA 185..336 65..216 340 81.5 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:58:26
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 14271805..14271957 129..281 690 96.7 Plus
chr2R 21145070 chr2R 14271614..14271741 2..129 595 97.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:21:01 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:58:24
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18384758..18384910 129..281 765 100 Plus
2R 25286936 2R 18384567..18384694 2..129 640 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:00:26
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 18385957..18386109 129..281 765 100 Plus
2R 25260384 2R 18385766..18385893 2..129 640 100 Plus
Blast to na_te.dros performed 2019-03-16 18:58:25
Subject Length Description Subject Range Query Range Score Percent Strand
HMS-Beagle 7062 HMS-Beagle Beagle 7062bp 1086..1160 277..205 108 69.2 Minus

RH09147.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:59:01 Download gff for RH09147.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 14271612..14271741 1..129 96 -> Plus
chr2R 14271806..14271957 130..282 96   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:40:41 Download gff for RH09147.complete
Subject Subject Range Query Range Percent Splice Strand
CG18107-RA 1..138 72..209 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:06:08 Download gff for RH09147.complete
Subject Subject Range Query Range Percent Splice Strand
CG18107-RA 1..138 72..209 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:21:05 Download gff for RH09147.complete
Subject Subject Range Query Range Percent Splice Strand
CG18107-RA 1..138 72..209 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:14:10 Download gff for RH09147.complete
Subject Subject Range Query Range Percent Splice Strand
CG18107-RA 1..138 72..209 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:57:20 Download gff for RH09147.complete
Subject Subject Range Query Range Percent Splice Strand
CG18107-RA 1..138 72..209 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:33:23 Download gff for RH09147.complete
Subject Subject Range Query Range Percent Splice Strand
CG18107-RA 1..282 1..282 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:06:08 Download gff for RH09147.complete
Subject Subject Range Query Range Percent Splice Strand
CG18107-RA 1..282 1..282 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:21:05 Download gff for RH09147.complete
Subject Subject Range Query Range Percent Splice Strand
CG18107-RA 1..280 2..282 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:14:10 Download gff for RH09147.complete
Subject Subject Range Query Range Percent Splice Strand
CG18107-RA 1..282 1..282 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:57:20 Download gff for RH09147.complete
Subject Subject Range Query Range Percent Splice Strand
CG18107-RA 1..280 2..282 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:59:01 Download gff for RH09147.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18384565..18384694 1..129 99 -> Plus
2R 18384759..18384910 130..282 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:59:01 Download gff for RH09147.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18384565..18384694 1..129 99 -> Plus
2R 18384759..18384910 130..282 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:59:01 Download gff for RH09147.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18384565..18384694 1..129 99 -> Plus
2R 18384759..18384910 130..282 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:21:05 Download gff for RH09147.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14272070..14272199 1..129 99 -> Plus
arm_2R 14272264..14272415 130..282 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:39:38 Download gff for RH09147.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18385764..18385893 1..129 99 -> Plus
2R 18385958..18386109 130..282 99   Plus

RH09147.pep Sequence

Translation from 71 to 244

> RH09147.pep
MRFFAIVTVFVLGLLALANGYSVVTRSRKCYHQWRLCELQCSWWQIEIFN
QNLYLAS*
Sequence RH09147.pep has no blast hits.

RH09147.hyp Sequence

Translation from 71 to 208

> RH09147.hyp
MRFFAIVTVFVLGLLALANAIPLSPDPGNVIINGDCVNCNVRGGK*

RH09147.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:02:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG18107-PA 45 CG18107-PA 1..45 1..45 234 100 Plus
IM2-PA 45 CG18106-PA 1..45 1..45 202 80 Plus
IM1-PA 45 CG18108-PA 1..45 1..45 202 82.2 Plus
IM3-PB 39 CG16844-PB 1..38 1..42 127 69 Plus
IM3-PA 39 CG16844-PA 1..38 1..42 127 69 Plus