Associations are from manual ordering of a clone or by a periodic analysis.
Clone Sequence Records
RH09147.complete Sequence
298 bp assembled on 2007-04-18
GenBank Submission: AY071684
> RH09147.complete
GATCAGTTGTAGTTGATCGTTTGTCCGGTGTGTTCAGCTTATAAAACCGG
ATCTATTAATTGAAAATCAATATGCGATTCTTTGCAATCGTCACTGTCTT
TGTGCTTGGTCTTCTGGCTTTGGCCAATGCTATTCCGTTGTCACCCGATC
CAGGAAATGTTATCATCAATGGCGACTGTGTGAATTGCAATGTTCGTGGT
GGCAAATAGAAATTTTTAATCAAAACTTATATTTAGCATCATAATAAAAA
TGTAATAAAATGAAAGCTATATTGTAAATTGCAAAAAAAAAAAAAAAA
RH09147.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:05:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG18107-RA | 283 | CG18107-RA | 3..282 | 2..281 | 1400 | 100 | Plus |
CG15067-RA | 871 | CG15067-RA | 785..871 | 281..195 | 435 | 100 | Minus |
IM1-RA | 524 | IM1-RA | 185..336 | 65..216 | 340 | 81.5 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:58:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2R | 21145070 | chr2R | 14271805..14271957 | 129..281 | 690 | 96.7 | Plus |
chr2R | 21145070 | chr2R | 14271614..14271741 | 2..129 | 595 | 97.7 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:21:01 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:58:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 18384758..18384910 | 129..281 | 765 | 100 | Plus |
2R | 25286936 | 2R | 18384567..18384694 | 2..129 | 640 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:00:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25260384 | 2R | 18385957..18386109 | 129..281 | 765 | 100 | Plus |
2R | 25260384 | 2R | 18385766..18385893 | 2..129 | 640 | 100 | Plus |
Blast to na_te.dros performed 2019-03-16 18:58:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
HMS-Beagle | 7062 | HMS-Beagle Beagle 7062bp | 1086..1160 | 277..205 | 108 | 69.2 | Minus |
RH09147.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:59:01 Download gff for
RH09147.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2R | 14271612..14271741 | 1..129 | 96 | -> | Plus |
chr2R | 14271806..14271957 | 130..282 | 96 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:40:41 Download gff for
RH09147.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18107-RA | 1..138 | 72..209 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:06:08 Download gff for
RH09147.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18107-RA | 1..138 | 72..209 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:21:05 Download gff for
RH09147.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18107-RA | 1..138 | 72..209 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:14:10 Download gff for
RH09147.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18107-RA | 1..138 | 72..209 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:57:20 Download gff for
RH09147.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18107-RA | 1..138 | 72..209 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:33:23 Download gff for
RH09147.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18107-RA | 1..282 | 1..282 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:06:08 Download gff for
RH09147.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18107-RA | 1..282 | 1..282 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:21:05 Download gff for
RH09147.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18107-RA | 1..280 | 2..282 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:14:10 Download gff for
RH09147.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18107-RA | 1..282 | 1..282 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:57:20 Download gff for
RH09147.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18107-RA | 1..280 | 2..282 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:59:01 Download gff for
RH09147.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 18384565..18384694 | 1..129 | 99 | -> | Plus |
2R | 18384759..18384910 | 130..282 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:59:01 Download gff for
RH09147.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 18384565..18384694 | 1..129 | 99 | -> | Plus |
2R | 18384759..18384910 | 130..282 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:59:01 Download gff for
RH09147.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 18384565..18384694 | 1..129 | 99 | -> | Plus |
2R | 18384759..18384910 | 130..282 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:21:05 Download gff for
RH09147.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 14272070..14272199 | 1..129 | 99 | -> | Plus |
arm_2R | 14272264..14272415 | 130..282 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:39:38 Download gff for
RH09147.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 18385764..18385893 | 1..129 | 99 | -> | Plus |
2R | 18385958..18386109 | 130..282 | 99 | | Plus |
RH09147.pep Sequence
Translation from 71 to 244
> RH09147.pep
MRFFAIVTVFVLGLLALANGYSVVTRSRKCYHQWRLCELQCSWWQIEIFN
QNLYLAS*
Sequence RH09147.pep has no blast hits.
RH09147.hyp Sequence
Translation from 71 to 208
> RH09147.hyp
MRFFAIVTVFVLGLLALANAIPLSPDPGNVIINGDCVNCNVRGGK*
RH09147.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:02:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG18107-PA | 45 | CG18107-PA | 1..45 | 1..45 | 234 | 100 | Plus |
IM2-PA | 45 | CG18106-PA | 1..45 | 1..45 | 202 | 80 | Plus |
IM1-PA | 45 | CG18108-PA | 1..45 | 1..45 | 202 | 82.2 | Plus |
IM3-PB | 39 | CG16844-PB | 1..38 | 1..42 | 127 | 69 | Plus |
IM3-PA | 39 | CG16844-PA | 1..38 | 1..42 | 127 | 69 | Plus |