Clone RH09340 Report

Search the DGRC for RH09340

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:93
Well:40
Vector:pFlc-1
Associated Gene/TranscriptCG13565-RA
Protein status:RH09340.pep: gold
Preliminary Size:303
Sequenced Size:608

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13565 2002-01-01 Sim4 clustering to Release 2
CG13565 2002-04-26 Blastp of sequenced clone
CG13565 2003-01-01 Sim4 clustering to Release 3
CG13565 2008-04-29 Release 5.5 accounting
CG13565 2008-08-15 Release 5.9 accounting
CG13565 2008-12-18 5.12 accounting

Clone Sequence Records

RH09340.complete Sequence

608 bp (608 high quality bases) assembled on 2002-04-26

GenBank Submission: AY113565

> RH09340.complete
GACAGTCATCTTCAAATCGCTCCCAAGTGCACCAGGCTAACGGTCAACGG
CTGGAATCATGAATCTATATGTGCTCCTGGCGGTGGTATCGGTGTTCCTG
AACTTCATTCACGCAGCGCCCGGTGTGGATATTTCCAACGACGAACTGCT
GGATGGAAAATATCTTTGTGAAGCTGGCTCGAAGAAGTACGATGGACCGT
TTATAGTGAGATTGATTTCGGCTGCCAATGGACAAACGGTCGTCTGCTAC
GAGTGCAGCCAGTCGGAGTTCAAGACGAAGTACTCGGTGAAGCAGTGCGC
GGCCGGCAAGATCGGGTCTGGCCATCACCGGGACCTGGTGCCCTACCTGG
TGAGGATGGACCCCCTGTACAAGGACACCTGGAGCAGTAAGCTCAAGCGG
AACTTCGACGAGATCGACAAGGCCTCCGCCAGCTTCAGCATCCTCAACCA
GCTCGTCTAGTGATACCTTCGACAGCGCGTGAATGTAAATGCCCATGGAT
ATGGATACGGACTCTGATAGCGGAAATACTCTAAAATGCTTCATGTCAAG
GGACTATAGAAAATAAAGCAGGTGCATCCTGGTAGAATAGCCAAAAAAAA
AAAAAAAA

RH09340.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:10:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG13565-RA 683 CG13565-RA 76..670 2..596 2975 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:03:35
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 19833024..19833407 592..209 1875 99.2 Minus
chr2R 21145070 chr2R 19834553..19834679 128..2 635 100 Minus
chr2R 21145070 chr2R 19834417..19834463 173..127 235 100 Minus
chr2R 21145070 chr2R 19833681..19833720 210..171 200 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:21:08 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:03:33
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23946955..23947342 596..209 1940 100 Minus
2R 25286936 2R 23948488..23948614 128..2 635 100 Minus
2R 25286936 2R 23948352..23948398 173..127 235 100 Minus
2R 25286936 2R 23947616..23947655 210..171 200 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:41:15
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 23948154..23948541 596..209 1940 100 Minus
2R 25260384 2R 23949687..23949813 128..2 635 100 Minus
2R 25260384 2R 23949551..23949597 173..127 235 100 Minus
2R 25260384 2R 23948815..23948854 210..171 200 100 Minus
Blast to na_te.dros performed 2019-03-16 07:03:33
Subject Length Description Subject Range Query Range Score Percent Strand
G2 3102 G2 G2 3102bp 2138..2223 395..480 105 60.9 Plus

RH09340.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:04:17 Download gff for RH09340.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 19833024..19833405 211..592 99 <- Minus
chr2R 19833681..19833717 174..210 100 <- Minus
chr2R 19834417..19834462 128..173 100 <- Minus
chr2R 19834554..19834679 1..127 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:40:48 Download gff for RH09340.complete
Subject Subject Range Query Range Percent Splice Strand
CG13565-RA 1..402 59..460 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:55:02 Download gff for RH09340.complete
Subject Subject Range Query Range Percent Splice Strand
CG13565-RA 1..402 59..460 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:43:11 Download gff for RH09340.complete
Subject Subject Range Query Range Percent Splice Strand
CG13565-RA 1..402 59..460 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:47:31 Download gff for RH09340.complete
Subject Subject Range Query Range Percent Splice Strand
CG13565-RA 1..402 59..460 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:26:23 Download gff for RH09340.complete
Subject Subject Range Query Range Percent Splice Strand
CG13565-RA 1..402 59..460 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:34:05 Download gff for RH09340.complete
Subject Subject Range Query Range Percent Splice Strand
CG13565-RA 1..591 2..592 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:55:02 Download gff for RH09340.complete
Subject Subject Range Query Range Percent Splice Strand
CG13565-RA 1..591 2..592 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:43:11 Download gff for RH09340.complete
Subject Subject Range Query Range Percent Splice Strand
CG13565-RA 1..593 1..592 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:47:32 Download gff for RH09340.complete
Subject Subject Range Query Range Percent Splice Strand
CG13565-RA 1..591 2..592 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:26:23 Download gff for RH09340.complete
Subject Subject Range Query Range Percent Splice Strand
CG13565-RA 1..593 1..592 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:04:17 Download gff for RH09340.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23946959..23947340 211..592 100 <- Minus
2R 23947616..23947652 174..210 100 <- Minus
2R 23948352..23948397 128..173 100 <- Minus
2R 23948489..23948614 1..127 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:04:17 Download gff for RH09340.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23946959..23947340 211..592 100 <- Minus
2R 23947616..23947652 174..210 100 <- Minus
2R 23948352..23948397 128..173 100 <- Minus
2R 23948489..23948614 1..127 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:04:17 Download gff for RH09340.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23946959..23947340 211..592 100 <- Minus
2R 23947616..23947652 174..210 100 <- Minus
2R 23948352..23948397 128..173 100 <- Minus
2R 23948489..23948614 1..127 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:43:11 Download gff for RH09340.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19834482..19834863 211..592 100 <- Minus
arm_2R 19835139..19835175 174..210 100 <- Minus
arm_2R 19835875..19835920 128..173 100 <- Minus
arm_2R 19836012..19836137 1..127 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:20:09 Download gff for RH09340.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23948176..23948557 211..592 100 <- Minus
2R 23948833..23948869 174..210 100 <- Minus
2R 23949569..23949614 128..173 100 <- Minus
2R 23949706..23949831 1..127 99   Minus

RH09340.hyp Sequence

Translation from 58 to 459

> RH09340.hyp
MNLYVLLAVVSVFLNFIHAAPGVDISNDELLDGKYLCEAGSKKYDGPFIV
RLISAANGQTVVCYECSQSEFKTKYSVKQCAAGKIGSGHHRDLVPYLVRM
DPLYKDTWSSKLKRNFDEIDKASASFSILNQLV*

RH09340.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:39:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG13565-PA 133 CG13565-PA 1..133 1..133 691 100 Plus
CG13565-PC 127 CG13565-PC 1..38 1..38 194 100 Plus
CG13565-PB 127 CG13565-PB 1..38 1..38 194 100 Plus

RH09340.pep Sequence

Translation from 58 to 459

> RH09340.pep
MNLYVLLAVVSVFLNFIHAAPGVDISNDELLDGKYLCEAGSKKYDGPFIV
RLISAANGQTVVCYECSQSEFKTKYSVKQCAAGKIGSGHHRDLVPYLVRM
DPLYKDTWSSKLKRNFDEIDKASASFSILNQLV*

RH09340.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:49:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12051-PA 138 GF12051-PA 1..138 1..133 579 79.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:49:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19976-PA 137 GG19976-PA 1..137 1..133 578 90.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:51:44
Subject Length Description Subject Range Query Range Score Percent Strand
Orcokinin-PA 133 CG13565-PA 1..133 1..133 691 100 Plus
Orcokinin-PC 127 CG13565-PC 1..38 1..38 194 100 Plus
Orcokinin-PB 127 CG13565-PB 1..38 1..38 194 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:49:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20713-PA 65 GI20713-PA 1..65 68..133 137 49.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:49:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10914-PA 139 GL10914-PA 1..139 1..133 521 76.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:49:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12366-PA 139 GA12366-PA 1..139 1..133 515 75.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:49:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15489-PA 133 GM15489-PA 1..133 1..133 695 98.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:49:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24991-PA 133 GD24991-PA 1..133 1..133 695 98.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:49:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19099-PA 141 GK19099-PA 1..140 1..133 431 57.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:49:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11509-PA 137 GE11509-PA 1..137 1..133 583 91.2 Plus