Clone RH09719 Report

Search the DGRC for RH09719

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:97
Well:19
Vector:pFlc-1
Associated Gene/TranscriptCG13751-RA
Protein status:RH09719.pep: gold
Preliminary Size:234
Sequenced Size:393

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13751 2001-12-13 Blastp of sequenced clone
CG13751 2002-01-01 Sim4 clustering to Release 2
CG13751 2003-01-01 Sim4 clustering to Release 3
CG13751 2008-04-29 Release 5.5 accounting
CG13751 2008-08-15 Release 5.9 accounting
CG13751 2008-12-18 5.12 accounting

Clone Sequence Records

RH09719.complete Sequence

393 bp (393 high quality bases) assembled on 2001-12-13

GenBank Submission: AY070672

> RH09719.complete
GACTTTATCGAGTGTACCCTACACTTAGCCAAGTTTCCAAGTGCACGAGT
CACCCAGCGGACTGTGTGTCATAGCAAAAGCTGAAATTTCTCGGGGGAAA
AATGCCTGTTTTGGAGCACATCAAAGCCATGGCAGAGACTCCGACTCCAG
CTGAGAACAGCCCTGCACCGGCAGACGAGAATGCTCCGCCCCAGGCAGTC
CGGGAACTGACGCAGACCGACCATCTCAACCGACGCCTTCTCAAATCGCT
CCTGGAAAACATGCAGGCCACCGAGGTTCTGGCGCAGGAGAACGGGAACG
GCTCCAACGAGGAGGACAACGATTTCGAAGAATAAATCCTTTTATTAGAG
TACAGTAAAACTAATGAGCTAAAACGGAAAAAAAAAAAAAAAA

RH09719.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:57:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG13751-RA 377 CG13751-RA 2..377 2..377 1880 100 Plus
MrgBP-RA 755 MrgBP-RA 703..755 378..326 265 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:20:46
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 4787795..4788170 2..377 1880 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:21:21 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:20:44
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8900242..8900618 2..378 1885 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:16:33
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 8901441..8901817 2..378 1885 100 Plus
Blast to na_te.dros performed on 2019-03-15 20:20:45 has no hits.

RH09719.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:21:40 Download gff for RH09719.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 4787794..4788170 1..377 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:40:57 Download gff for RH09719.complete
Subject Subject Range Query Range Percent Splice Strand
CG13751-RA 1..234 102..335 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:56:19 Download gff for RH09719.complete
Subject Subject Range Query Range Percent Splice Strand
CG13751-RA 1..234 102..335 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 03:06:34 Download gff for RH09719.complete
Subject Subject Range Query Range Percent Splice Strand
CG13751-RA 1..234 102..335 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:38:57 Download gff for RH09719.complete
Subject Subject Range Query Range Percent Splice Strand
CG13751-RA 1..234 102..335 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:34:33 Download gff for RH09719.complete
Subject Subject Range Query Range Percent Splice Strand
CG13751-RA 1..234 102..335 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:10:02 Download gff for RH09719.complete
Subject Subject Range Query Range Percent Splice Strand
CG13751-RA 2..377 2..377 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:56:19 Download gff for RH09719.complete
Subject Subject Range Query Range Percent Splice Strand
CG13751-RA 2..377 2..377 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:06:34 Download gff for RH09719.complete
Subject Subject Range Query Range Percent Splice Strand
CG13751-RA 2..377 2..377 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:38:57 Download gff for RH09719.complete
Subject Subject Range Query Range Percent Splice Strand
CG13751-RA 2..377 2..377 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:34:33 Download gff for RH09719.complete
Subject Subject Range Query Range Percent Splice Strand
CG13751-RA 2..377 2..377 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:21:40 Download gff for RH09719.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8900241..8900617 1..377 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:21:40 Download gff for RH09719.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8900241..8900617 1..377 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:21:40 Download gff for RH09719.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8900241..8900617 1..377 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:06:34 Download gff for RH09719.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4787746..4788122 1..377 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:22:02 Download gff for RH09719.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8901440..8901816 1..377 99   Plus

RH09719.pep Sequence

Translation from 101 to 334

> RH09719.pep
MPVLEHIKAMAETPTPAENSPAPADENAPPQAVRELTQTDHLNRRLLKSL
LENMQATEVLAQENGNGSNEEDNDFEE*

RH09719.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:36:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12387-PA 78 GF12387-PA 1..78 1..77 250 67.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:36:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23392-PA 77 GG23392-PA 1..77 1..77 340 89.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:36:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23106-PA 74 GH23106-PA 1..74 1..77 141 51.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:39:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG13751-PA 77 CG13751-PA 1..77 1..77 396 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:36:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18929-PA 74 GI18929-PA 1..55 1..57 136 56.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:36:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17131-PA 83 GL17131-PA 1..83 1..77 193 57.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:36:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12507-PA 83 GA12507-PA 1..83 1..77 193 57.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:36:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21073-PA 77 GM21073-PA 1..77 1..77 382 98.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:36:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10609-PA 77 GD10609-PA 1..77 1..77 382 98.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:36:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21300-PA 74 GJ21300-PA 1..74 1..77 140 48.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:36:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19234-PA 77 GE19234-PA 1..77 1..77 349 89.6 Plus

RH09719.hyp Sequence

Translation from 101 to 334

> RH09719.hyp
MPVLEHIKAMAETPTPAENSPAPADENAPPQAVRELTQTDHLNRRLLKSL
LENMQATEVLAQENGNGSNEEDNDFEE*

RH09719.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:48:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG13751-PA 77 CG13751-PA 1..77 1..77 396 100 Plus