BDGP Sequence Production Resources |
Search the DGRC for RH09719
Library: | RH |
Tissue Source: | Drosophila melanogaster adult head |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2001-04-30 |
Comments: | Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 97 |
Well: | 19 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG13751-RA |
Protein status: | RH09719.pep: gold |
Preliminary Size: | 234 |
Sequenced Size: | 393 |
Gene | Date | Evidence |
---|---|---|
CG13751 | 2001-12-13 | Blastp of sequenced clone |
CG13751 | 2002-01-01 | Sim4 clustering to Release 2 |
CG13751 | 2003-01-01 | Sim4 clustering to Release 3 |
CG13751 | 2008-04-29 | Release 5.5 accounting |
CG13751 | 2008-08-15 | Release 5.9 accounting |
CG13751 | 2008-12-18 | 5.12 accounting |
393 bp (393 high quality bases) assembled on 2001-12-13
GenBank Submission: AY070672
> RH09719.complete GACTTTATCGAGTGTACCCTACACTTAGCCAAGTTTCCAAGTGCACGAGT CACCCAGCGGACTGTGTGTCATAGCAAAAGCTGAAATTTCTCGGGGGAAA AATGCCTGTTTTGGAGCACATCAAAGCCATGGCAGAGACTCCGACTCCAG CTGAGAACAGCCCTGCACCGGCAGACGAGAATGCTCCGCCCCAGGCAGTC CGGGAACTGACGCAGACCGACCATCTCAACCGACGCCTTCTCAAATCGCT CCTGGAAAACATGCAGGCCACCGAGGTTCTGGCGCAGGAGAACGGGAACG GCTCCAACGAGGAGGACAACGATTTCGAAGAATAAATCCTTTTATTAGAG TACAGTAAAACTAATGAGCTAAAACGGAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 4787795..4788170 | 2..377 | 1880 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 8900242..8900618 | 2..378 | 1885 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 8901441..8901817 | 2..378 | 1885 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 4787794..4788170 | 1..377 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13751-RA | 1..234 | 102..335 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13751-RA | 1..234 | 102..335 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13751-RA | 1..234 | 102..335 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13751-RA | 1..234 | 102..335 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13751-RA | 1..234 | 102..335 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13751-RA | 2..377 | 2..377 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13751-RA | 2..377 | 2..377 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13751-RA | 2..377 | 2..377 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13751-RA | 2..377 | 2..377 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13751-RA | 2..377 | 2..377 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 8900241..8900617 | 1..377 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 8900241..8900617 | 1..377 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 8900241..8900617 | 1..377 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 4787746..4788122 | 1..377 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 8901440..8901816 | 1..377 | 99 | Plus |
Translation from 101 to 334
> RH09719.pep MPVLEHIKAMAETPTPAENSPAPADENAPPQAVRELTQTDHLNRRLLKSL LENMQATEVLAQENGNGSNEEDNDFEE*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF12387-PA | 78 | GF12387-PA | 1..78 | 1..77 | 250 | 67.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG23392-PA | 77 | GG23392-PA | 1..77 | 1..77 | 340 | 89.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH23106-PA | 74 | GH23106-PA | 1..74 | 1..77 | 141 | 51.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG13751-PA | 77 | CG13751-PA | 1..77 | 1..77 | 396 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI18929-PA | 74 | GI18929-PA | 1..55 | 1..57 | 136 | 56.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL17131-PA | 83 | GL17131-PA | 1..83 | 1..77 | 193 | 57.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA12507-PA | 83 | GA12507-PA | 1..83 | 1..77 | 193 | 57.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM21073-PA | 77 | GM21073-PA | 1..77 | 1..77 | 382 | 98.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD10609-PA | 77 | GD10609-PA | 1..77 | 1..77 | 382 | 98.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ21300-PA | 74 | GJ21300-PA | 1..74 | 1..77 | 140 | 48.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE19234-PA | 77 | GE19234-PA | 1..77 | 1..77 | 349 | 89.6 | Plus |
Translation from 101 to 334
> RH09719.hyp MPVLEHIKAMAETPTPAENSPAPADENAPPQAVRELTQTDHLNRRLLKSL LENMQATEVLAQENGNGSNEEDNDFEE*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG13751-PA | 77 | CG13751-PA | 1..77 | 1..77 | 396 | 100 | Plus |