Clone RH09855 Report

Search the DGRC for RH09855

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:98
Well:55
Vector:pFlc-1
Associated Gene/TranscriptDrep-3-RA
Protein status:RH09855.pep: gold
Sequenced Size:1570

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8364 2007-09-25 DGC5 pick
Rep3 2008-04-29 Release 5.5 accounting
Rep3 2008-04-29 Picked prior to 5.5
Rep3 2008-08-15 Release 5.9 accounting
Rep3 2008-12-18 5.12 accounting

Clone Sequence Records

RH09855.complete Sequence

1570 bp assembled on 2007-12-03

GenBank Submission: BT031295

> RH09855.complete
GATTCCAAGTTCGGCCGGCTTTTGTTGCACTTGGCTGCTGTGAGTAGTCG
GCTCGCGATCTCAGCCAGAATCGCGTATTGTAATTGTTGCCGGAAGATGT
GAAGAATTCGGTTTTTAACTTAAAGTGCACGCAAGGAGTCCAGACAAGGC
GAACAAACTCTCGAGACGAGGTAAATACATGACAGCAATGAATGCGGATG
AGACAAAGCTGGCTGGAATGCCTCAAGGAGCTGAGGAGGAGCAGGAACCG
GAGAGGGAGCAGAAGAAGGAGAGCGATGGAGCAGCAGCTGCAGCAGGAGT
ACAGTGTGATCCTGATAGCAGAATAGTGGCTCCGCCGCCCAGGCAGCGGA
CTCTGACAAGGACGGCCGAACTGGACGCGGACTGCGAGGACATCGAGTTA
GATGCCGACGATGGTTTGGACGATGCGGCGGATAGCATCACCTTGGAGTT
GGCCCTATCGCCGCACAGCAGCGCCACGCCCACGCCCTCGCCCACCACCG
CCGACGAGGATTTCGCCCAGCTGGACAACAGCAAGCCCTTCAAGATCAAG
GACATCACGAGGAACATCCGCAAGGCAGTTGTGGCCACAACGCTGTCGGA
GCTGCGGACGAAGGTGTCGCTGAAATTTGAGCGGGCTCAGCCGGCGATAC
ACCTGGATTGCGATGGCACCGAGGTCGACGATGAGGAGTACTTCAGCACT
CTGGAGCCAAATGCCGAATTGATTGCCGTCTTTCCTGGCGAGCAGTGGCG
CGATCCCAGTGACTACAATGCCAATCTGCGTCGCACATCGCTGGATGCAC
AGCGTCTGCGGAGTCTGGTGAGCAAACTGCAGCCGAACTATATGAACGAT
GATGATTTGGATAAGCTGTCGAACATGGATCCCAACTCCCTGGTGGATAT
CACGGGTCGGGAGCCCAAGGACAACGAATACTCAGCCAGAAGCGATGCCG
CACGGCTATCAACGGAATTGTCTTGCTAAGGGAATGCATTTTTCCCTCAA
CGAATTAACGTACATATGTTAGCTTAAGAAATGTGTGAATTGGTATGTAA
ATAGGGAATTTGTACGAGTTTATATGGCTAGACGGAGTATTTTTGGAAAA
CGTTTTGATGACAGGCACTTGATGCGACCGATATTTGGATGGTTGTTTTT
GCTGCTAACCGTAGATCAGAAAGTTGTGTATTTTTCGAGCCCACATTGTC
GTAGAGCAACTCACCCCGAATGTCTATAATCAGCCGCTAATTGTTCCTAG
ACCAATAGTCGTGTATGAGCCCATAGCCTGGAGTGCCTTGAAGGCCGATC
TCCAGTTATGGACTACCTTATCCTCACCTCACCTAACCTCACTCAGCGGA
CGATTAACGAGCTGCAGAATAGATTTTGATCTAGACAAATAGTTATTAAA
AAATATATATATATATTTTCCATAGCAGAATCCTTGTGAATGTCACACGA
ATACCAATGCAGATTGGGTTATTAGGGAGCAACTAGAACTTGATGTTACT
GAATCTCAATTAAATGAATTAATAATGGAATAAACCTTCACCCTAGGTGC
ACAGAAAAAAAAAAAAAAAA

RH09855.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:36:37
Subject Length Description Subject Range Query Range Score Percent Strand
Drep-3-RA 1822 Drep-3-RA 2..1557 2..1557 7780 100 Plus
Drep-3.c 1827 Drep-3.c 2..1562 2..1557 7705 99.6 Plus
Drep-3-RB 2106 Drep-3-RB 434..1860 131..1557 7135 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:46:39
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 7949057..7949858 755..1554 3915 99.5 Plus
chr2R 21145070 chr2R 7943197..7943610 131..544 2070 100 Plus
chr2R 21145070 chr2R 7948738..7948953 539..754 1050 99.1 Plus
chr2R 21145070 chr2R 7942313..7942442 2..131 635 99.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:21:26 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:46:37
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12061821..12062623 755..1557 4015 100 Plus
2R 25286936 2R 12055973..12056386 131..544 2070 100 Plus
2R 25286936 2R 12061502..12061717 539..754 1065 99.5 Plus
2R 25286936 2R 12055089..12055218 2..131 650 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:33:30
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 12063020..12063822 755..1557 4015 100 Plus
2R 25260384 2R 12057172..12057585 131..544 2070 100 Plus
2R 25260384 2R 12062701..12062916 539..754 1065 99.5 Plus
2R 25260384 2R 12056288..12056417 2..131 650 100 Plus
2R 25260384 2R 12049286..12049384 650..748 150 76.7 Plus
2R 25260384 2R 12049845..12049909 842..906 145 81.5 Plus
Blast to na_te.dros performed on 2019-03-16 09:46:38 has no hits.

RH09855.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:47:17 Download gff for RH09855.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 7948744..7948953 545..754 99 -> Plus
chr2R 7942312..7942442 1..131 98 -> Plus
chr2R 7943198..7943610 132..544 90 -> Plus
chr2R 7949057..7949858 755..1554 96   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:41:01 Download gff for RH09855.complete
Subject Subject Range Query Range Percent Splice Strand
Rep3-RA 1..801 179..979 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:06:53 Download gff for RH09855.complete
Subject Subject Range Query Range Percent Splice Strand
Drep-3-RA 1..801 179..979 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:37:22 Download gff for RH09855.complete
Subject Subject Range Query Range Percent Splice Strand
Drep-3-RB 1..801 179..979 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:53:10 Download gff for RH09855.complete
Subject Subject Range Query Range Percent Splice Strand
Rep3-RA 1..801 179..979 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:20:12 Download gff for RH09855.complete
Subject Subject Range Query Range Percent Splice Strand
Drep-3-RB 1..801 179..979 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:02:56 Download gff for RH09855.complete
Subject Subject Range Query Range Percent Splice Strand
Rep3-RA 2..1554 2..1554 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:06:53 Download gff for RH09855.complete
Subject Subject Range Query Range Percent Splice Strand
Drep-3-RA 2..1554 2..1554 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:37:22 Download gff for RH09855.complete
Subject Subject Range Query Range Percent Splice Strand
Drep-3-RA 1..1553 2..1554 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:53:10 Download gff for RH09855.complete
Subject Subject Range Query Range Percent Splice Strand
Rep3-RA 2..1554 2..1554 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:20:12 Download gff for RH09855.complete
Subject Subject Range Query Range Percent Splice Strand
Drep-3-RA 1..1553 2..1554 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:47:17 Download gff for RH09855.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12055088..12055218 1..131 99 -> Plus
2R 12055974..12056386 132..544 100 -> Plus
2R 12061508..12061717 545..754 100 -> Plus
2R 12061821..12062620 755..1554 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:47:17 Download gff for RH09855.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12055088..12055218 1..131 99 -> Plus
2R 12055974..12056386 132..544 100 -> Plus
2R 12061508..12061717 545..754 100 -> Plus
2R 12061821..12062620 755..1554 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:47:17 Download gff for RH09855.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12055088..12055218 1..131 99 -> Plus
2R 12055974..12056386 132..544 100 -> Plus
2R 12061508..12061717 545..754 100 -> Plus
2R 12061821..12062620 755..1554 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:37:22 Download gff for RH09855.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7942593..7942723 1..131 99 -> Plus
arm_2R 7943479..7943891 132..544 100 -> Plus
arm_2R 7949013..7949222 545..754 100 -> Plus
arm_2R 7949326..7950125 755..1554 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:59:10 Download gff for RH09855.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12062707..12062916 545..754 100 -> Plus
2R 12057173..12057585 132..544 100 -> Plus
2R 12063020..12063819 755..1554 100   Plus
2R 12056287..12056417 1..131 99 -> Plus

RH09855.pep Sequence

Translation from 178 to 978

> RH09855.pep
MTAMNADETKLAGMPQGAEEEQEPEREQKKESDGAAAAAGVQCDPDSRIV
APPPRQRTLTRTAELDADCEDIELDADDGLDDAADSITLELALSPHSSAT
PTPSPTTADEDFAQLDNSKPFKIKDITRNIRKAVVATTLSELRTKVSLKF
ERAQPAIHLDCDGTEVDDEEYFSTLEPNAELIAVFPGEQWRDPSDYNANL
RRTSLDAQRLRSLVSKLQPNYMNDDDLDKLSNMDPNSLVDITGREPKDNE
YSARSDAARLSTELSC*

RH09855.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:49:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12289-PA 260 GF12289-PA 1..260 1..266 852 74.9 Plus
Dana\GF12288-PA 300 GF12288-PA 9..169 119..245 383 49.7 Plus
Dana\GF11819-PA 608 GF11819-PA 110..204 100..190 159 40.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:49:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20243-PA 262 GG20243-PA 1..262 1..266 1098 91.7 Plus
Dere\GG20241-PA 297 GG20241-PA 9..168 116..245 401 52.5 Plus
Dere\GG23432-PA 478 GG23432-PA 10..84 119..190 155 44 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:49:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20858-PA 243 GH20858-PA 21..243 59..266 744 71.2 Plus
Dgri\GH20857-PA 301 GH20857-PA 13..177 116..245 390 49.7 Plus
Dgri\GH20347-PA 534 GH20347-PA 43..134 102..190 166 40.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:14:33
Subject Length Description Subject Range Query Range Score Percent Strand
Drep3-PA 266 CG8364-PA 1..266 1..266 1364 100 Plus
Drep3-PB 266 CG8364-PB 1..266 1..266 1364 100 Plus
Drep1-PA 297 CG8357-PA 9..168 116..245 382 51.9 Plus
Drep1-PB 306 CG8357-PB 9..168 116..245 382 51.9 Plus
Drep2-PB 549 CG1975-PB 59..151 101..190 150 38.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:49:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20964-PA 282 GI20964-PA 101..282 86..266 740 80.2 Plus
Dmoj\GI20962-PA 286 GI20962-PA 12..168 116..245 405 54.1 Plus
Dmoj\GI20016-PA 539 GI20016-PA 65..139 119..190 156 44 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:49:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17096-PA 261 GL17096-PA 49..261 51..266 866 82.4 Plus
Dper\GL17094-PA 311 GL17094-PA 13..180 119..245 370 48.5 Plus
Dper\GL17583-PA 476 GL17583-PA 10..84 119..190 156 44 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:49:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21021-PA 261 GA21021-PA 21..261 20..266 875 75.7 Plus
Dpse\GA21015-PA 310 GA21015-PA 13..180 119..245 370 48.5 Plus
Dpse\GA15166-PA 476 GA15166-PA 10..84 119..190 156 44 Plus
Dpse\GA15166-PB 539 GA15166-PB 73..147 119..190 156 44 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:49:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21330-PA 258 GM21330-PA 1..258 4..266 1044 94.3 Plus
Dsec\GM21329-PA 326 GM21329-PA 9..168 116..245 398 52.5 Plus
Dsec\GM21115-PA 387 GM21115-PA 10..84 119..190 155 44 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:49:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10838-PA 258 GD10838-PA 1..258 4..266 1294 95.1 Plus
Dsim\GD10836-PA 297 GD10836-PA 9..168 116..245 401 52.5 Plus
Dsim\GD10649-PA 481 GD10649-PA 10..84 119..190 156 44 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:49:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20685-PA 252 GJ20685-PA 75..252 86..266 744 80.1 Plus
Dvir\GJ20683-PA 288 GJ20683-PA 11..167 116..245 398 53.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:49:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21340-PA 257 GK21340-PA 12..257 38..266 771 66.3 Plus
Dwil\GK21339-PA 316 GK21339-PA 17..191 119..245 370 46.4 Plus
Dwil\GK19508-PA 466 GK19508-PA 8..84 117..190 156 42.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:49:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12403-PA 270 GE12403-PA 1..270 4..266 1066 88.9 Plus
Dyak\GE12400-PA 297 GE12400-PA 9..168 116..245 400 52.5 Plus
Dyak\GE19270-PA 481 GE19270-PA 10..84 119..190 156 44 Plus

RH09855.hyp Sequence

Translation from 178 to 978

> RH09855.hyp
MTAMNADETKLAGMPQGAEEEQEPEREQKKESDGAAAAAGVQCDPDSRIV
APPPRQRTLTRTAELDADCEDIELDADDGLDDAADSITLELALSPHSSAT
PTPSPTTADEDFAQLDNSKPFKIKDITRNIRKAVVATTLSELRTKVSLKF
ERAQPAIHLDCDGTEVDDEEYFSTLEPNAELIAVFPGEQWRDPSDYNANL
RRTSLDAQRLRSLVSKLQPNYMNDDDLDKLSNMDPNSLVDITGREPKDNE
YSARSDAARLSTELSC*

RH09855.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:33:25
Subject Length Description Subject Range Query Range Score Percent Strand
Drep-3-PA 266 CG8364-PA 1..266 1..266 1364 100 Plus
Drep-3-PB 266 CG8364-PB 1..266 1..266 1364 100 Plus
Drep-1-PA 297 CG8357-PA 9..168 116..245 382 51.9 Plus
Drep-1-PB 306 CG8357-PB 9..168 116..245 382 51.9 Plus
Drep-2-PB 549 CG1975-PB 59..151 101..190 150 38.7 Plus