Clone RH09920 Report

Search the DGRC for RH09920

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:99
Well:20
Vector:pFlc-1
Associated Gene/TranscriptCG1319-RB
Protein status:RH09920.pep: gold
Preliminary Size:477
Sequenced Size:864

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1319 2002-01-01 Sim4 clustering to Release 2
CG1319 2002-05-18 Blastp of sequenced clone
CG1319 2008-04-29 Release 5.5 accounting
CG1319 2008-08-15 Release 5.9 accounting
CG1319 2008-12-18 5.12 accounting

Clone Sequence Records

RH09920.complete Sequence

864 bp (864 high quality bases) assembled on 2002-05-18

GenBank Submission: AY119160

> RH09920.complete
GACACACACAACTTCACGTTTAACAAAATTTAATTGATTTCCTTATTATT
TAACAACCGATCGCAGCGACACGAGTGGGTGCGTGTTGTCAGTTATAGTA
AGAGATTGCAAAGGAATCCTAACCAGAATGCTAGTCATAAACTCATGCAG
AGCTGCCTCCAGATTGGCGCTACGCAGCCTCAATTTGCGATCGCCGATCG
CAACGCGTACTTTCTCGACGGGATTGGCCCTGAAAACGAAAGATGTTGTT
AACATAACCTTCGTGCGTGCCAATGGGGACAAGATTAAGACGTCCGGAAA
AGTGGGTGACTCCCTGCTGGACGTGGTGGTCAACAACAATGTGGATCTGG
ATGGTTTCGGGGCCTGTGAGGGCACGCTGACCTGCTCCACCTGCCACCTG
ATCTTCAAGACCAGCGATTTCGAGAAACTGCCCGACAAACCCGGTGATGA
GGAGCTGGACATGCTGGATTTGGCGTACGAACTGACGGACACCTCGCGGC
TGGGCTGCCAGATCACCCTGTCCAAGGATATGGAGGGCCTGGAGGTACAT
GTGCCCTCCACCATCAATGACGCACGTGCCGCGTAGATAGACACCACCAC
TGTTATCAATTGTTACAAATTTGAGTGCTAATTCGCTTTAGTTCAACCTA
GATGTAGTCAATATTTTTGAACGAAATCGTATGTATTGTCCCAGGGACAC
AAACCTCAGGCGGCTATAATGGATGCGCGCATTAATCCGATTCCAGTTGC
GGATTAGCGTCCGCTGTTGTTTTTAAAGTGTTTAAGCTCAAAGGGATTAG
ATCAATATGTAAATAAGTGTGTTGCAATAAATTTACATGTATTTTCGCAA
AAAAAAAAAAAAAA

RH09920.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:39:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG1319-RB 955 CG1319-RB 107..951 3..847 4225 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:53:10
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 4292217..4292817 247..847 3005 100 Plus
chr3L 24539361 chr3L 4291885..4292128 3..246 1220 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:21:28 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:53:08
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 4292831..4293431 247..847 3005 100 Plus
3L 28110227 3L 4292499..4292742 3..246 1220 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:12:44
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 4292831..4293431 247..847 3005 100 Plus
3L 28103327 3L 4292499..4292742 3..246 1220 100 Plus
Blast to na_te.dros performed on 2019-03-15 22:53:08 has no hits.

RH09920.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:53:54 Download gff for RH09920.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 4291883..4292128 1..246 99 -> Plus
chr3L 4292217..4292817 247..848 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:41:03 Download gff for RH09920.complete
Subject Subject Range Query Range Percent Splice Strand
CG1319-RA 1..102 145..246 100 -> Plus
CG1319-RA 138..477 247..586 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:11:06 Download gff for RH09920.complete
Subject Subject Range Query Range Percent Splice Strand
CG1319-RB 1..459 128..586 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:35:25 Download gff for RH09920.complete
Subject Subject Range Query Range Percent Splice Strand
CG1319-RB 1..459 128..586 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:01:57 Download gff for RH09920.complete
Subject Subject Range Query Range Percent Splice Strand
CG1319-RA 1..102 145..246 100 -> Plus
CG1319-RA 138..477 247..586 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:37:30 Download gff for RH09920.complete
Subject Subject Range Query Range Percent Splice Strand
CG1319-RB 1..459 128..586 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:32:41 Download gff for RH09920.complete
Subject Subject Range Query Range Percent Splice Strand
CG1319-RA 1..246 1..246 99 -> Plus
CG1319-RA 282..882 247..848 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:11:06 Download gff for RH09920.complete
Subject Subject Range Query Range Percent Splice Strand
CG1319-RB 1..847 1..848 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:35:25 Download gff for RH09920.complete
Subject Subject Range Query Range Percent Splice Strand
CG1319-RB 16..862 1..848 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:01:57 Download gff for RH09920.complete
Subject Subject Range Query Range Percent Splice Strand
CG1319-RA 1..246 1..246 99 -> Plus
CG1319-RA 282..882 247..848 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:37:30 Download gff for RH09920.complete
Subject Subject Range Query Range Percent Splice Strand
CG1319-RB 16..862 1..848 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:53:54 Download gff for RH09920.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4292497..4292742 1..246 99 -> Plus
3L 4292831..4293431 247..848 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:53:54 Download gff for RH09920.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4292497..4292742 1..246 99 -> Plus
3L 4292831..4293431 247..848 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:53:54 Download gff for RH09920.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4292497..4292742 1..246 99 -> Plus
3L 4292831..4293431 247..848 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:35:25 Download gff for RH09920.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 4292497..4292742 1..246 99 -> Plus
arm_3L 4292831..4293431 247..848 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:33:37 Download gff for RH09920.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4292497..4292742 1..246 99 -> Plus
3L 4292831..4293431 247..848 99   Plus

RH09920.pep Sequence

Translation from 127 to 585

> RH09920.pep
MLVINSCRAASRLALRSLNLRSPIATRTFSTGLALKTKDVVNITFVRANG
DKIKTSGKVGDSLLDVVVNNNVDLDGFGACEGTLTCSTCHLIFKTSDFEK
LPDKPGDEELDMLDLAYELTDTSRLGCQITLSKDMEGLEVHVPSTINDAR
AA*

RH09920.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 03:15:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF25062-PA 152 GF25062-PA 1..152 1..152 720 90.1 Plus
Dana\GF23741-PA 172 GF23741-PA 55..157 39..144 237 44.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 03:15:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15219-PA 152 GG15219-PA 1..152 1..152 776 98 Plus
Dere\GG14049-PA 172 GG14049-PA 11..157 3..144 231 36.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 03:15:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16023-PA 163 GH16023-PA 1..163 1..152 614 73 Plus
Dgri\GH16986-PA 170 GH16986-PA 53..155 39..144 237 43.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:15:46
Subject Length Description Subject Range Query Range Score Percent Strand
Fdx2-PB 152 CG1319-PB 1..152 1..152 772 100 Plus
Fdx1-PB 172 CG4205-PB 53..156 37..143 228 42.1 Plus
Fdx1-PA 172 CG4205-PA 53..156 37..143 228 42.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 03:15:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12288-PA 161 GI12288-PA 1..161 1..152 638 76.4 Plus
Dmoj\GI11398-PA 170 GI11398-PA 53..155 39..144 236 43.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 03:15:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16335-PA 158 GL16335-PA 1..158 1..152 690 85.4 Plus
Dper\GL22634-PA 170 GL22634-PA 11..155 5..144 204 34.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 03:15:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12105-PA 158 GA12105-PA 1..158 1..152 698 86.1 Plus
Dpse\GA24929-PA 170 GA24929-PA 11..154 5..143 204 35.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 03:15:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14650-PA 152 GM14650-PA 1..152 1..152 787 100 Plus
Dsec\GM24883-PA 172 GM24883-PA 51..157 36..144 230 42.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 03:15:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13836-PA 152 GD13836-PA 1..152 1..152 775 98.7 Plus
Dsim\GD12935-PA 172 GD12935-PA 51..157 36..144 230 42.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 03:15:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13225-PA 160 GJ13225-PA 1..160 1..152 638 76.2 Plus
Dvir\GJ13593-PA 170 GJ13593-PA 53..155 39..144 233 43.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 03:15:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11844-PA 159 GK11844-PA 1..159 1..152 633 79.9 Plus
Dwil\GK16567-PA 173 GK16567-PA 56..159 39..145 226 40.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 03:15:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21438-PA 116 GE21438-PA 5..116 41..152 586 100 Plus
Dyak\GE21252-PA 172 GE21252-PA 11..157 3..144 228 34.7 Plus

RH09920.hyp Sequence

Translation from 127 to 585

> RH09920.hyp
MLVINSCRAASRLALRSLNLRSPIATRTFSTGLALKTKDVVNITFVRANG
DKIKTSGKVGDSLLDVVVNNNVDLDGFGACEGTLTCSTCHLIFKTSDFEK
LPDKPGDEELDMLDLAYELTDTSRLGCQITLSKDMEGLEVHVPSTINDAR
AA*

RH09920.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:49:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG1319-PB 152 CG1319-PB 1..152 1..152 772 100 Plus
Fdxh-PB 172 CG4205-PB 53..156 37..143 228 42.1 Plus
Fdxh-PA 172 CG4205-PA 53..156 37..143 228 42.1 Plus