Clone RH10246 Report

Search the DGRC for RH10246

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:102
Well:46
Vector:pFlc-1
Associated Gene/TranscriptmRpL55-RA
Protein status:RH10246.pep: gold
Preliminary Size:324
Sequenced Size:464

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14283 2001-12-17 Blastp of sequenced clone
CG14283 2002-01-01 Sim4 clustering to Release 2
mRpL55 2008-04-29 Release 5.5 accounting
mRpL55 2008-08-15 Release 5.9 accounting
mRpL55 2008-12-18 5.12 accounting

Clone Sequence Records

RH10246.complete Sequence

464 bp (464 high quality bases) assembled on 2001-12-17

GenBank Submission: AY071686

> RH10246.complete
GCCACTATCAGCTGCCTGGCAGCAAAAACACGATTTAAGTGTAGCTCTTA
TTTAGTGTAAATATTGTGATTATCAATTAAAATGTTGCTGAAACAGTTGC
CCCAGGCTGTTCAGCAGATACGCTGCATCTCATCGGCCACGACGGCGGTT
ACCAGGCTGCATCGCTCGGTTTACTGCCGGCTATATCCCACAGTTGTGGT
GCAACCCGATGGATCCACGATAAACATCCGCTATCACGAGCCCAGGAAGA
TTATCAAGCTTCCCTTGGATCTGAGCACCTTAACCGATGCGGAGCGCAGA
GCGAGATTGGAGGCCCGCAAGCCGCGCAAGAAGGTCAAGATCATGGAGGA
GGTGGAGGACAACTTCAACGCCAAGAAGTACATGAAGTACATCAAAAAGA
AGTAGCCGCATTTTATTCACTATTTGTTAAATAAAACACGAAAGCCCGAA
AAAAAAAAAAAAAA

RH10246.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:37:31
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL55-RA 483 mRpL55-RA 30..475 3..448 2230 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:46:55
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 14918628..14918883 258..3 1280 100 Minus
chr3R 27901430 chr3R 14918382..14918573 448..257 960 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:21:35 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:46:53
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 19094642..19094897 258..3 1280 100 Minus
3R 32079331 3R 19094396..19094587 448..257 960 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:04:54
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 18835473..18835728 258..3 1280 100 Minus
3R 31820162 3R 18835227..18835418 448..257 960 100 Minus
Blast to na_te.dros performed 2019-03-16 19:46:53
Subject Length Description Subject Range Query Range Score Percent Strand
Doc3-element 4740 Doc3-element DOC3 4740bp 1159..1206 354..401 105 68.8 Plus

RH10246.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:47:47 Download gff for RH10246.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 14918382..14918571 259..448 100 <- Minus
chr3R 14918628..14918883 1..258 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:41:07 Download gff for RH10246.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL55-RA 1..324 82..405 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:00:55 Download gff for RH10246.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL55-RA 1..324 82..405 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:34:16 Download gff for RH10246.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL55-RA 1..324 82..405 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:25:34 Download gff for RH10246.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL55-RA 1..324 82..405 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:42:28 Download gff for RH10246.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL55-RA 1..324 82..405 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:27:07 Download gff for RH10246.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL55-RA 1..446 3..448 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:00:55 Download gff for RH10246.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL55-RA 2..451 1..448 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:34:16 Download gff for RH10246.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL55-RA 2..451 1..448 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:25:35 Download gff for RH10246.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL55-RA 1..446 3..448 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:42:28 Download gff for RH10246.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL55-RA 5..454 1..448 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:47:47 Download gff for RH10246.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19094396..19094585 259..448 100 <- Minus
3R 19094642..19094897 1..258 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:47:47 Download gff for RH10246.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19094396..19094585 259..448 100 <- Minus
3R 19094642..19094897 1..258 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:47:47 Download gff for RH10246.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19094396..19094585 259..448 100 <- Minus
3R 19094642..19094897 1..258 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:34:16 Download gff for RH10246.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 14920118..14920307 259..448 100 <- Minus
arm_3R 14920364..14920619 1..258 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:01:03 Download gff for RH10246.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18835473..18835728 1..258 99   Minus
3R 18835227..18835416 259..448 100 <- Minus

RH10246.hyp Sequence

Translation from 81 to 404

> RH10246.hyp
MLLKQLPQAVQQIRCISSATTAVTRLHRSVYCRLYPTVVVQPDGSTINIR
YHEPRKIIKLPLDLSTLTDAERRARLEARKPRKKVKIMEEVEDNFNAKKY
MKYIKKK*

RH10246.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:58:47
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL55-PA 107 CG14283-PA 1..107 1..107 542 100 Plus

RH10246.pep Sequence

Translation from 81 to 404

> RH10246.pep
MLLKQLPQAVQQIRCISSATTAVTRLHRSVYCRLYPTVVVQPDGSTINIR
YHEPRKIIKLPLDLSTLTDAERRARLEARKPRKKVKIMEEVEDNFNAKKY
MKYIKKK*

RH10246.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:15:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18943-PA 108 GF18943-PA 1..97 1..97 487 93.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:15:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16185-PA 107 GG16185-PA 1..107 1..107 551 98.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:15:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22393-PA 107 GH22393-PA 1..105 2..106 481 83.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:24:48
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL55-PA 107 CG14283-PA 1..107 1..107 542 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:15:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22004-PA 107 GI22004-PA 1..106 2..107 479 84 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:15:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23712-PA 107 GL23712-PA 1..97 1..97 480 91.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:15:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22435-PA 107 GA22435-PA 1..97 1..97 480 91.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:15:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23337-PA 107 GM23337-PA 1..107 1..107 555 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:15:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20135-PA 107 GD20135-PA 1..107 1..107 550 99.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:15:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14358-PA 107 GJ14358-PA 1..104 2..105 449 79.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:15:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13715-PA 107 GK13715-PA 1..97 1..97 439 83.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:15:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11084-PA 107 GE11084-PA 1..107 1..107 539 96.3 Plus
Dyak\GE25153-PA 107 GE25153-PA 1..107 1..107 539 96.3 Plus