BDGP Sequence Production Resources |
Search the DGRC for RH10246
Library: | RH |
Tissue Source: | Drosophila melanogaster adult head |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2001-04-30 |
Comments: | Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 102 |
Well: | 46 |
Vector: | pFlc-1 |
Associated Gene/Transcript | mRpL55-RA |
Protein status: | RH10246.pep: gold |
Preliminary Size: | 324 |
Sequenced Size: | 464 |
Gene | Date | Evidence |
---|---|---|
CG14283 | 2001-12-17 | Blastp of sequenced clone |
CG14283 | 2002-01-01 | Sim4 clustering to Release 2 |
mRpL55 | 2008-04-29 | Release 5.5 accounting |
mRpL55 | 2008-08-15 | Release 5.9 accounting |
mRpL55 | 2008-12-18 | 5.12 accounting |
464 bp (464 high quality bases) assembled on 2001-12-17
GenBank Submission: AY071686
> RH10246.complete GCCACTATCAGCTGCCTGGCAGCAAAAACACGATTTAAGTGTAGCTCTTA TTTAGTGTAAATATTGTGATTATCAATTAAAATGTTGCTGAAACAGTTGC CCCAGGCTGTTCAGCAGATACGCTGCATCTCATCGGCCACGACGGCGGTT ACCAGGCTGCATCGCTCGGTTTACTGCCGGCTATATCCCACAGTTGTGGT GCAACCCGATGGATCCACGATAAACATCCGCTATCACGAGCCCAGGAAGA TTATCAAGCTTCCCTTGGATCTGAGCACCTTAACCGATGCGGAGCGCAGA GCGAGATTGGAGGCCCGCAAGCCGCGCAAGAAGGTCAAGATCATGGAGGA GGTGGAGGACAACTTCAACGCCAAGAAGTACATGAAGTACATCAAAAAGA AGTAGCCGCATTTTATTCACTATTTGTTAAATAAAACACGAAAGCCCGAA AAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mRpL55-RA | 483 | mRpL55-RA | 30..475 | 3..448 | 2230 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Doc3-element | 4740 | Doc3-element DOC3 4740bp | 1159..1206 | 354..401 | 105 | 68.8 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 14918382..14918571 | 259..448 | 100 | <- | Minus |
chr3R | 14918628..14918883 | 1..258 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL55-RA | 1..324 | 82..405 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL55-RA | 1..324 | 82..405 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL55-RA | 1..324 | 82..405 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL55-RA | 1..324 | 82..405 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL55-RA | 1..324 | 82..405 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL55-RA | 1..446 | 3..448 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL55-RA | 2..451 | 1..448 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL55-RA | 2..451 | 1..448 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL55-RA | 1..446 | 3..448 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL55-RA | 5..454 | 1..448 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 19094396..19094585 | 259..448 | 100 | <- | Minus |
3R | 19094642..19094897 | 1..258 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 19094396..19094585 | 259..448 | 100 | <- | Minus |
3R | 19094642..19094897 | 1..258 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 19094396..19094585 | 259..448 | 100 | <- | Minus |
3R | 19094642..19094897 | 1..258 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 14920118..14920307 | 259..448 | 100 | <- | Minus |
arm_3R | 14920364..14920619 | 1..258 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 18835473..18835728 | 1..258 | 99 | Minus | |
3R | 18835227..18835416 | 259..448 | 100 | <- | Minus |
Translation from 81 to 404
> RH10246.hyp MLLKQLPQAVQQIRCISSATTAVTRLHRSVYCRLYPTVVVQPDGSTINIR YHEPRKIIKLPLDLSTLTDAERRARLEARKPRKKVKIMEEVEDNFNAKKY MKYIKKK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mRpL55-PA | 107 | CG14283-PA | 1..107 | 1..107 | 542 | 100 | Plus |
Translation from 81 to 404
> RH10246.pep MLLKQLPQAVQQIRCISSATTAVTRLHRSVYCRLYPTVVVQPDGSTINIR YHEPRKIIKLPLDLSTLTDAERRARLEARKPRKKVKIMEEVEDNFNAKKY MKYIKKK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF18943-PA | 108 | GF18943-PA | 1..97 | 1..97 | 487 | 93.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG16185-PA | 107 | GG16185-PA | 1..107 | 1..107 | 551 | 98.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH22393-PA | 107 | GH22393-PA | 1..105 | 2..106 | 481 | 83.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mRpL55-PA | 107 | CG14283-PA | 1..107 | 1..107 | 542 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI22004-PA | 107 | GI22004-PA | 1..106 | 2..107 | 479 | 84 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL23712-PA | 107 | GL23712-PA | 1..97 | 1..97 | 480 | 91.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA22435-PA | 107 | GA22435-PA | 1..97 | 1..97 | 480 | 91.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM23337-PA | 107 | GM23337-PA | 1..107 | 1..107 | 555 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD20135-PA | 107 | GD20135-PA | 1..107 | 1..107 | 550 | 99.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ14358-PA | 107 | GJ14358-PA | 1..104 | 2..105 | 449 | 79.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK13715-PA | 107 | GK13715-PA | 1..97 | 1..97 | 439 | 83.5 | Plus |