BDGP Sequence Production Resources |
Search the DGRC for RH10862
Library: | RH |
Tissue Source: | Drosophila melanogaster adult head |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2001-04-30 |
Comments: | Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 108 |
Well: | 62 |
Vector: | pFlc-1 |
Associated Gene/Transcript | mRpS6-RA |
Protein status: | RH10862.pep: gold |
Preliminary Size: | 444 |
Sequenced Size: | 639 |
Gene | Date | Evidence |
---|---|---|
CG15016 | 2001-12-13 | Blastp of sequenced clone |
CG15016 | 2002-01-01 | Sim4 clustering to Release 2 |
CG15016 | 2003-01-01 | Sim4 clustering to Release 3 |
mRpS6 | 2008-04-29 | Release 5.5 accounting |
mRpS6 | 2008-08-15 | Release 5.9 accounting |
mRpS6 | 2008-12-18 | 5.12 accounting |
639 bp (639 high quality bases) assembled on 2001-12-13
GenBank Submission: AY070674
> RH10862.complete GCCTTGCATCAGCTGTTAACACTATCAGCTGGTGGGTCAACAATTACATT AGATTTACTAACTTTTTAATGAATTAAAACTTGAGAGAAACAACGTTAAT ATAAGAAATTAAATTCCTTACCAGCTCATACAATTCACCGGTCACAATGC CTTCTTACGAACTAGCACTGGTGCTCCGCCAATTGCCTCGCCCCGAACTG ATTTCCGTGATTAGGCGAACGGCCGAGTCCATCCTGGACAAGGGCGGCAT TATCCGGAAGCTGGAGAACCTGGGATCCCGCGCCCTGCCCCACAAAGTCA GCGAACACGGGGTGGTTCACCGGGAAGGCACCCACTTCACCATCGCCTTT GATACGGCGCCCACTAAGATCGCAGACTTGAAGGAGGAGTTTGGCCGCGA CATCGACATCATACGGCGCTACATCTTCAAGGTGGAGGAGCCCGAGCAGA AGCCCTGCACGCTGCACGAGGAGATGCTGCCACCCGCGTATCGCAAGGAT GTGCAGGAGATCATTGCGGCCGCCCAGAAGAAGCAAAAGAAGAAGTTCAA CTACAACTCCGGCCTGGACTACTATCCCTTCCAAAAATAAAACACCAAAT AAAACGCGTTAATTATGTATGCTAAAAAAAAAAAAAAAA
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 4363937..4364127 | 1..191 | 96 | -> | Plus |
chr3L | 4364194..4364625 | 192..623 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS6-RA | 1..444 | 147..590 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS6-RA | 1..444 | 147..590 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS6-RA | 1..444 | 147..590 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS6-RA | 1..444 | 147..590 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS6-RA | 1..444 | 147..590 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS6-RA | 2..623 | 2..623 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS6-RA | 2..623 | 2..623 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS6-RB | 6..628 | 1..623 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS6-RA | 2..623 | 2..623 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS6-RB | 6..628 | 1..623 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 4364555..4364745 | 1..191 | 99 | -> | Plus |
3L | 4364812..4365243 | 192..623 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 4364555..4364745 | 1..191 | 99 | -> | Plus |
3L | 4364812..4365243 | 192..623 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 4364555..4364745 | 1..191 | 99 | -> | Plus |
3L | 4364812..4365243 | 192..623 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 4364555..4364745 | 1..191 | 99 | -> | Plus |
arm_3L | 4364812..4365243 | 192..623 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 4364812..4365243 | 192..623 | 100 | Plus | |
3L | 4364555..4364745 | 1..191 | 99 | -> | Plus |
Translation from 146 to 589
> RH10862.pep MPSYELALVLRQLPRPELISVIRRTAESILDKGGIIRKLENLGSRALPHK VSEHGVVHREGTHFTIAFDTAPTKIADLKEEFGRDIDIIRRYIFKVEEPE QKPCTLHEEMLPPAYRKDVQEIIAAAQKKQKKKFNYNSGLDYYPFQK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF25065-PA | 147 | GF25065-PA | 1..147 | 1..147 | 659 | 90.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG15222-PA | 147 | GG15222-PA | 1..147 | 1..147 | 761 | 98 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH15198-PA | 147 | GH15198-PA | 1..147 | 1..147 | 697 | 88.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mRpS6-PB | 147 | CG15016-PB | 1..147 | 1..147 | 760 | 100 | Plus |
mRpS6-PA | 147 | CG15016-PA | 1..147 | 1..147 | 760 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI16716-PA | 147 | GI16716-PA | 1..147 | 1..147 | 672 | 85 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL17892-PA | 147 | GL17892-PA | 1..147 | 1..147 | 719 | 91.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA13435-PA | 147 | GA13435-PA | 1..147 | 1..147 | 719 | 91.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM14653-PA | 147 | GM14653-PA | 1..147 | 1..147 | 748 | 97.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD13839-PA | 147 | GD13839-PA | 1..147 | 1..147 | 773 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ12460-PA | 147 | GJ12460-PA | 1..147 | 1..147 | 680 | 86.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK11671-PA | 147 | GK11671-PA | 1..147 | 1..147 | 666 | 83 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE21441-PA | 147 | GE21441-PA | 1..147 | 1..147 | 764 | 98.6 | Plus |
Translation from 146 to 589
> RH10862.hyp MPSYELALVLRQLPRPELISVIRRTAESILDKGGIIRKLENLGSRALPHK VSEHGVVHREGTHFTIAFDTAPTKIADLKEEFGRDIDIIRRYIFKVEEPE QKPCTLHEEMLPPAYRKDVQEIIAAAQKKQKKKFNYNSGLDYYPFQK*