Clone RH10862 Report

Search the DGRC for RH10862

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:108
Well:62
Vector:pFlc-1
Associated Gene/TranscriptmRpS6-RA
Protein status:RH10862.pep: gold
Preliminary Size:444
Sequenced Size:639

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15016 2001-12-13 Blastp of sequenced clone
CG15016 2002-01-01 Sim4 clustering to Release 2
CG15016 2003-01-01 Sim4 clustering to Release 3
mRpS6 2008-04-29 Release 5.5 accounting
mRpS6 2008-08-15 Release 5.9 accounting
mRpS6 2008-12-18 5.12 accounting

Clone Sequence Records

RH10862.complete Sequence

639 bp (639 high quality bases) assembled on 2001-12-13

GenBank Submission: AY070674

> RH10862.complete
GCCTTGCATCAGCTGTTAACACTATCAGCTGGTGGGTCAACAATTACATT
AGATTTACTAACTTTTTAATGAATTAAAACTTGAGAGAAACAACGTTAAT
ATAAGAAATTAAATTCCTTACCAGCTCATACAATTCACCGGTCACAATGC
CTTCTTACGAACTAGCACTGGTGCTCCGCCAATTGCCTCGCCCCGAACTG
ATTTCCGTGATTAGGCGAACGGCCGAGTCCATCCTGGACAAGGGCGGCAT
TATCCGGAAGCTGGAGAACCTGGGATCCCGCGCCCTGCCCCACAAAGTCA
GCGAACACGGGGTGGTTCACCGGGAAGGCACCCACTTCACCATCGCCTTT
GATACGGCGCCCACTAAGATCGCAGACTTGAAGGAGGAGTTTGGCCGCGA
CATCGACATCATACGGCGCTACATCTTCAAGGTGGAGGAGCCCGAGCAGA
AGCCCTGCACGCTGCACGAGGAGATGCTGCCACCCGCGTATCGCAAGGAT
GTGCAGGAGATCATTGCGGCCGCCCAGAAGAAGCAAAAGAAGAAGTTCAA
CTACAACTCCGGCCTGGACTACTATCCCTTCCAAAAATAAAACACCAAAT
AAAACGCGTTAATTATGTATGCTAAAAAAAAAAAAAAAA

RH10862.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:48:36
Subject Length Description Subject Range Query Range Score Percent Strand
mRpS6-RA 696 mRpS6-RA 10..635 2..627 3130 100 Plus
mRpS6.a 597 mRpS6.a 69..572 124..627 2520 100 Plus
mRpS6.a 597 mRpS6.a 40..69 2..31 150 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:03:45
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 4364194..4364625 192..623 2085 98.8 Plus
chr3L 24539361 chr3L 4363938..4364127 2..191 860 96.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:21:50 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:03:43
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 4364812..4365247 192..627 2180 100 Plus
3L 28110227 3L 4364556..4364745 2..191 950 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:14:48
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 4364812..4365247 192..627 2180 100 Plus
3L 28103327 3L 4364556..4364745 2..191 950 100 Plus
Blast to na_te.dros performed on 2019-03-16 07:03:43 has no hits.

RH10862.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:04:23 Download gff for RH10862.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 4363937..4364127 1..191 96 -> Plus
chr3L 4364194..4364625 192..623 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:41:16 Download gff for RH10862.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS6-RA 1..444 147..590 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:17:02 Download gff for RH10862.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS6-RA 1..444 147..590 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:43:20 Download gff for RH10862.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS6-RA 1..444 147..590 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:43:08 Download gff for RH10862.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS6-RA 1..444 147..590 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:26:28 Download gff for RH10862.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS6-RA 1..444 147..590 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:49:34 Download gff for RH10862.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS6-RA 2..623 2..623 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:17:02 Download gff for RH10862.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS6-RA 2..623 2..623 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:43:20 Download gff for RH10862.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS6-RB 6..628 1..623 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:43:08 Download gff for RH10862.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS6-RA 2..623 2..623 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:26:28 Download gff for RH10862.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS6-RB 6..628 1..623 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:04:23 Download gff for RH10862.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4364555..4364745 1..191 99 -> Plus
3L 4364812..4365243 192..623 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:04:23 Download gff for RH10862.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4364555..4364745 1..191 99 -> Plus
3L 4364812..4365243 192..623 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:04:23 Download gff for RH10862.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4364555..4364745 1..191 99 -> Plus
3L 4364812..4365243 192..623 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:43:20 Download gff for RH10862.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 4364555..4364745 1..191 99 -> Plus
arm_3L 4364812..4365243 192..623 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:19:17 Download gff for RH10862.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4364812..4365243 192..623 100   Plus
3L 4364555..4364745 1..191 99 -> Plus

RH10862.pep Sequence

Translation from 146 to 589

> RH10862.pep
MPSYELALVLRQLPRPELISVIRRTAESILDKGGIIRKLENLGSRALPHK
VSEHGVVHREGTHFTIAFDTAPTKIADLKEEFGRDIDIIRRYIFKVEEPE
QKPCTLHEEMLPPAYRKDVQEIIAAAQKKQKKKFNYNSGLDYYPFQK*

RH10862.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:33:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF25065-PA 147 GF25065-PA 1..147 1..147 659 90.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:33:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15222-PA 147 GG15222-PA 1..147 1..147 761 98 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:33:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15198-PA 147 GH15198-PA 1..147 1..147 697 88.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:39:09
Subject Length Description Subject Range Query Range Score Percent Strand
mRpS6-PB 147 CG15016-PB 1..147 1..147 760 100 Plus
mRpS6-PA 147 CG15016-PA 1..147 1..147 760 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:33:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16716-PA 147 GI16716-PA 1..147 1..147 672 85 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:33:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17892-PA 147 GL17892-PA 1..147 1..147 719 91.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:33:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13435-PA 147 GA13435-PA 1..147 1..147 719 91.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:33:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14653-PA 147 GM14653-PA 1..147 1..147 748 97.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:33:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13839-PA 147 GD13839-PA 1..147 1..147 773 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:33:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12460-PA 147 GJ12460-PA 1..147 1..147 680 86.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:33:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11671-PA 147 GK11671-PA 1..147 1..147 666 83 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:33:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21441-PA 147 GE21441-PA 1..147 1..147 764 98.6 Plus

RH10862.hyp Sequence

Translation from 146 to 589

> RH10862.hyp
MPSYELALVLRQLPRPELISVIRRTAESILDKGGIIRKLENLGSRALPHK
VSEHGVVHREGTHFTIAFDTAPTKIADLKEEFGRDIDIIRRYIFKVEEPE
QKPCTLHEEMLPPAYRKDVQEIIAAAQKKQKKKFNYNSGLDYYPFQK*

RH10862.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:43:09
Subject Length Description Subject Range Query Range Score Percent Strand
mRpS6-PB 147 CG15016-PB 1..147 1..147 760 100 Plus
mRpS6-PA 147 CG15016-PA 1..147 1..147 760 100 Plus