Clone RH11203 Report

Search the DGRC for RH11203

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:112
Well:3
Vector:pFlc-1
Associated Gene/TranscriptCG6463-RA
Protein status:RH11203.pep: gold
Preliminary Size:690
Sequenced Size:612

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6463 2001-12-13 Blastp of sequenced clone
CG6463 2002-01-01 Sim4 clustering to Release 2
CG6463 2003-01-01 Sim4 clustering to Release 3
CG6463 2008-04-29 Release 5.5 accounting
CG6463 2008-08-15 Release 5.9 accounting
CG6463 2008-12-18 5.12 accounting

Clone Sequence Records

RH11203.complete Sequence

612 bp (612 high quality bases) assembled on 2001-12-13

GenBank Submission: AY070675

> RH11203.complete
GCTCGACACTTCACAGCACTGGGCAACAGCTGTTACAAAATAAAGTCGTG
CGGAAAATTAAGCATTTTCGGCTAAAAGTCTATTGCAAACATGGCCAAGA
TCATTAAGGCGTCCACAGGTTTGACTGGACTCGCCGTGTCCACCAATCCA
CACCACACGCTGAGTGCTCTGTATGGCAAGATTCTGCGGGCGGTGTCCAA
GATGCCACAGGACGCCAGCTACCGCAAGTACACGGAGCAACTGGTCAAGC
AGCGCGCCGATTCTGTGGCCCAACACAAGGACATCACTGCCCTGGAAAAG
GCCGTCGGTTGCGGTCAAGTGGAGGAGCTAATTGTCCAGGCCGAGAACGA
GCTGATCCTTGCGCGCAAAATGCTCGGCTGGAAGCCCTGGGAGAAGTTGG
TCCAAGCCGCGCCTGCCAAGCAGTGGGACTGGCCACCAGCCCAGATCATG
GAGCCCAAGGTTTAGATTCACACTTAGTACTAATTAATCTACAGCAAATC
GAAATGAGAAGAGAGCAATAAATCCGTTGATAAGCCAGTGGCTTTATCAG
CTAAAAAATAATTGAGCTTTAATCAAATGAATAAACCTGGAACAGCAAAA
AAAAAAAAAAAA

RH11203.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:48:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG6463-RA 729 CG6463-RA 38..633 2..597 2980 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:50:36
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 10684515..10684813 572..274 1450 99 Minus
chr3L 24539361 chr3L 10685006..10685168 273..111 755 97.5 Minus
chr3L 24539361 chr3L 10685296..10685407 111..2 465 96.4 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:21:53 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:50:34
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 10693183..10693506 597..274 1620 100 Minus
3L 28110227 3L 10693706..10693868 273..111 815 100 Minus
3L 28110227 3L 10693997..10694106 111..2 550 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:14:34
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 10686283..10686606 597..274 1620 100 Minus
3L 28103327 3L 10686806..10686968 273..111 815 100 Minus
3L 28103327 3L 10687097..10687206 111..2 550 100 Minus
Blast to na_te.dros performed on 2019-03-16 13:50:34 has no hits.

RH11203.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:51:29 Download gff for RH11203.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 10684474..10684502 568..596 96 <- Minus
chr3L 10684520..10684813 274..567 98 <- Minus
chr3L 10685006..10685167 112..273 97 <- Minus
chr3L 10685296..10685407 1..111 95   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:41:19 Download gff for RH11203.complete
Subject Subject Range Query Range Percent Splice Strand
CG6463-RA 1..375 91..465 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:16:40 Download gff for RH11203.complete
Subject Subject Range Query Range Percent Splice Strand
CG6463-RA 1..375 91..465 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 14:36:55 Download gff for RH11203.complete
Subject Subject Range Query Range Percent Splice Strand
CG6463-RA 1..375 91..465 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:42:47 Download gff for RH11203.complete
Subject Subject Range Query Range Percent Splice Strand
CG6463-RA 1..375 91..465 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:20:09 Download gff for RH11203.complete
Subject Subject Range Query Range Percent Splice Strand
CG6463-RA 1..375 91..465 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:49:04 Download gff for RH11203.complete
Subject Subject Range Query Range Percent Splice Strand
CG6463-RA 1..595 2..596 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:16:39 Download gff for RH11203.complete
Subject Subject Range Query Range Percent Splice Strand
CG6463-RA 1..595 2..596 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 14:36:55 Download gff for RH11203.complete
Subject Subject Range Query Range Percent Splice Strand
CG6463-RA 1..597 1..596 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:42:47 Download gff for RH11203.complete
Subject Subject Range Query Range Percent Splice Strand
CG6463-RA 1..595 2..596 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:20:09 Download gff for RH11203.complete
Subject Subject Range Query Range Percent Splice Strand
CG6463-RA 1..597 1..596 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:51:29 Download gff for RH11203.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10693184..10693506 274..596 100 <- Minus
3L 10693706..10693867 112..273 100 <- Minus
3L 10693997..10694106 1..111 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:51:29 Download gff for RH11203.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10693184..10693506 274..596 100 <- Minus
3L 10693706..10693867 112..273 100 <- Minus
3L 10693997..10694106 1..111 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:51:29 Download gff for RH11203.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10693184..10693506 274..596 100 <- Minus
3L 10693706..10693867 112..273 100 <- Minus
3L 10693997..10694106 1..111 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 14:36:55 Download gff for RH11203.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 10686284..10686606 274..596 100 <- Minus
arm_3L 10686806..10686967 112..273 100 <- Minus
arm_3L 10687097..10687206 1..111 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:18:52 Download gff for RH11203.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10686284..10686606 274..596 100 <- Minus
3L 10686806..10686967 112..273 100 <- Minus
3L 10687097..10687206 1..111 99   Minus

RH11203.hyp Sequence

Translation from 90 to 464

> RH11203.hyp
MAKIIKASTGLTGLAVSTNPHHTLSALYGKILRAVSKMPQDASYRKYTEQ
LVKQRADSVAQHKDITALEKAVGCGQVEELIVQAENELILARKMLGWKPW
EKLVQAAPAKQWDWPPAQIMEPKV*

RH11203.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:08:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG6463-PA 124 CG6463-PA 1..124 1..124 639 100 Plus

RH11203.pep Sequence

Translation from 90 to 464

> RH11203.pep
MAKIIKASTGLTGLAVSTNPHHTLSALYGKILRAVSKMPQDASYRKYTEQ
LVKQRADSVAQHKDITALEKAVGCGQVEELIVQAENELILARKMLGWKPW
EKLVQAAPAKQWDWPPAQIMEPKV*

RH11203.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:33:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23822-PA 124 GF23822-PA 1..124 1..124 557 83.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:33:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13964-PA 124 GG13964-PA 1..124 1..124 636 98.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:33:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15571-PA 124 GH15571-PA 1..124 1..124 573 87.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:38:51
Subject Length Description Subject Range Query Range Score Percent Strand
ND-13B-PA 124 CG6463-PA 1..124 1..124 639 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:33:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16846-PA 124 GI16846-PA 1..124 1..124 599 89.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:33:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20740-PA 124 GL20740-PA 1..124 1..124 603 91.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:33:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19615-PA 124 GA19615-PA 1..124 1..124 603 91.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:33:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24801-PA 124 GM24801-PA 1..124 1..124 640 99.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:33:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12852-PA 124 GD12852-PA 1..124 1..124 640 99.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:33:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12596-PA 124 GJ12596-PA 1..124 1..124 594 89.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:33:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16793-PA 124 GK16793-PA 1..124 1..124 583 87.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:33:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20262-PA 124 GE20262-PA 1..124 1..124 645 100 Plus