BDGP Sequence Production Resources |
Search the DGRC for RH11830
Library: | RH |
Tissue Source: | Drosophila melanogaster adult head |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2001-04-30 |
Comments: | Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 118 |
Well: | 30 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG34217-RA |
Protein status: | RH11830.pep: gold |
Sequenced Size: | 753 |
Gene | Date | Evidence |
---|---|---|
CG34217-RA | 2009-10-15 | EST screening |
753 bp assembled on 2009-10-23
GenBank Submission: BT100159.1
> RH11830.complete TTGGTCAAAAACTAAATTATTGCAATCAAGAGCGCGCAGTGACTTTCAGG CGTGCATTGAAAAATCTCAGAAATTATAAAAACAATTTAATTGAAAAATT TTAATTTTACCATGCCAGGAAATCTGTTTCAAGTGTTACTAACTGTGGCG ATCCTGCCAGCTATTAGTTTGGCATCTAGTTCTGAAGATGGTCTGCACCA TTACCGTGCTTCTCCAAAGCTCACGGGTCCTGTGAAGCTCCTACACGATC CCGAGGACACCATTCTGAACACCTTGGATGGCGCTCTGGAGAAGATCTCC ACCATCTACATGCAGGCCTTGTTCGCTGGTACCCACACCCCGGAACTGGA AGCCCCACTCCGAGCCCTCGAAATCGAGTTGTTCGATCTGCTGGACGAGC TCTATAATCAGAATCGTCTCAAGGACTATATAAAGTACGAGGCGGAAGTG ACGCGACAAATGATAATCTACAACATGCTGAAGAGATTGTTTGGCTACAC ACAGGAAAATGAGGCTGGATCTGTCTGAGCTGTAAATTCTAAATATGTTT TCTAATTATAAGTCCTTCATCAATGCAAAAGTAGACGAAGTGAATTTTAA TATACCACACCATACTATATACTATTGTATAATGCCTAAAATTCTTACTC ATACAAATATTCAAGGTTTTTATTTTTTACTTTCTTATGTTACTTTGGTA TTATCTTCGATATTTCAAAATAAAGTTAAAGTAAAGTAAAAAAAAAAAAA AAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG34217-RA | 526 | CG34217-RA | 2..526 | 4..528 | 2625 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 4115527..4116260 | 737..4 | 3640 | 99.7 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 8227986..8228723 | 741..4 | 3690 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 8229185..8229922 | 741..4 | 3690 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 4115527..4116261 | 1..737 | 94 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34217-RA | 1..417 | 112..528 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34217-RA | 1..417 | 112..528 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34217-RA | 1..417 | 112..528 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34217-RA | 1..417 | 112..528 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34217-RA | 2..526 | 4..528 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34217-RA | 2..526 | 4..528 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34217-RA | 2..738 | 2..737 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34217-RA | 2..738 | 2..737 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 8227990..8228724 | 1..737 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 8227990..8228724 | 1..737 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 8227990..8228724 | 1..737 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 4115495..4116229 | 1..737 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 8229189..8229923 | 1..737 | 99 | Minus |
Translation from 111 to 527
> RH11830.hyp MPGNLFQVLLTVAILPAISLASSSEDGLHHYRASPKLTGPVKLLHDPEDT ILNTLDGALEKISTIYMQALFAGTHTPELEAPLRALEIELFDLLDELYNQ NRLKDYIKYEAEVTRQMIIYNMLKRLFGYTQENEAGSV*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG34217-PA | 138 | CG34217-PA | 1..138 | 1..138 | 699 | 100 | Plus |
Translation from 111 to 527
> RH11830.pep MPGNLFQVLLTVAILPAISLASSSEDGLHHYRASPKLTGPVKLLHDPEDT ILNTLDGALEKISTIYMQALFAGTHTPELEAPLRALEIELFDLLDELYNQ NRLKDYIKYEAEVTRQMIIYNMLKRLFGYTQENEAGSV*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF12603-PA | 140 | GF12603-PA | 20..132 | 21..133 | 488 | 79.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG10663-PA | 134 | GG10663-PA | 1..134 | 5..138 | 652 | 93.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH20826-PA | 122 | GH20826-PA | 14..119 | 29..134 | 392 | 70.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG34217-PA | 138 | CG34217-PA | 1..138 | 1..138 | 699 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI20926-PA | 130 | GI20926-PA | 24..128 | 30..134 | 318 | 68.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL10879-PA | 141 | GL10879-PA | 8..137 | 6..135 | 533 | 76.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA24521-PA | 141 | GA24521-PA | 8..138 | 6..136 | 534 | 76.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM20708-PA | 138 | GM20708-PA | 1..138 | 1..138 | 685 | 94.2 | Plus |
Dsec\GM20709-PA | 138 | GM20709-PA | 1..138 | 1..138 | 685 | 94.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD15289-PA | 138 | GD15289-PA | 1..138 | 1..138 | 659 | 90.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ20654-PA | 134 | GJ20654-PA | 27..131 | 31..134 | 408 | 72.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK15771-PA | 136 | GK15771-PA | 19..135 | 22..134 | 432 | 71.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE23207-PA | 111 | GE23207-PA | 1..111 | 28..138 | 560 | 95.5 | Plus |