Clone RH11830 Report

Search the DGRC for RH11830

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:118
Well:30
Vector:pFlc-1
Associated Gene/TranscriptCG34217-RA
Protein status:RH11830.pep: gold
Sequenced Size:753

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34217-RA 2009-10-15 EST screening

Clone Sequence Records

RH11830.complete Sequence

753 bp assembled on 2009-10-23

GenBank Submission: BT100159.1

> RH11830.complete
TTGGTCAAAAACTAAATTATTGCAATCAAGAGCGCGCAGTGACTTTCAGG
CGTGCATTGAAAAATCTCAGAAATTATAAAAACAATTTAATTGAAAAATT
TTAATTTTACCATGCCAGGAAATCTGTTTCAAGTGTTACTAACTGTGGCG
ATCCTGCCAGCTATTAGTTTGGCATCTAGTTCTGAAGATGGTCTGCACCA
TTACCGTGCTTCTCCAAAGCTCACGGGTCCTGTGAAGCTCCTACACGATC
CCGAGGACACCATTCTGAACACCTTGGATGGCGCTCTGGAGAAGATCTCC
ACCATCTACATGCAGGCCTTGTTCGCTGGTACCCACACCCCGGAACTGGA
AGCCCCACTCCGAGCCCTCGAAATCGAGTTGTTCGATCTGCTGGACGAGC
TCTATAATCAGAATCGTCTCAAGGACTATATAAAGTACGAGGCGGAAGTG
ACGCGACAAATGATAATCTACAACATGCTGAAGAGATTGTTTGGCTACAC
ACAGGAAAATGAGGCTGGATCTGTCTGAGCTGTAAATTCTAAATATGTTT
TCTAATTATAAGTCCTTCATCAATGCAAAAGTAGACGAAGTGAATTTTAA
TATACCACACCATACTATATACTATTGTATAATGCCTAAAATTCTTACTC
ATACAAATATTCAAGGTTTTTATTTTTTACTTTCTTATGTTACTTTGGTA
TTATCTTCGATATTTCAAAATAAAGTTAAAGTAAAGTAAAAAAAAAAAAA
AAA

RH11830.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:55:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG34217-RA 526 CG34217-RA 2..526 4..528 2625 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:07:05
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 4115527..4116260 737..4 3640 99.7 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:22:01 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:07:03
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8227986..8228723 741..4 3690 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:52:08
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 8229185..8229922 741..4 3690 100 Minus
Blast to na_te.dros performed on 2019-03-16 13:07:04 has no hits.

RH11830.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:07:55 Download gff for RH11830.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 4115527..4116261 1..737 94   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-23 10:26:42 Download gff for RH11830.complete
Subject Subject Range Query Range Percent Splice Strand
CG34217-RA 1..417 112..528 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:46:31 Download gff for RH11830.complete
Subject Subject Range Query Range Percent Splice Strand
CG34217-RA 1..417 112..528 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 14:24:31 Download gff for RH11830.complete
Subject Subject Range Query Range Percent Splice Strand
CG34217-RA 1..417 112..528 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:09:37 Download gff for RH11830.complete
Subject Subject Range Query Range Percent Splice Strand
CG34217-RA 1..417 112..528 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-10-23 10:26:39 Download gff for RH11830.complete
Subject Subject Range Query Range Percent Splice Strand
CG34217-RA 2..526 4..528 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:46:31 Download gff for RH11830.complete
Subject Subject Range Query Range Percent Splice Strand
CG34217-RA 2..526 4..528 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 14:24:31 Download gff for RH11830.complete
Subject Subject Range Query Range Percent Splice Strand
CG34217-RA 2..738 2..737 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:09:37 Download gff for RH11830.complete
Subject Subject Range Query Range Percent Splice Strand
CG34217-RA 2..738 2..737 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:07:55 Download gff for RH11830.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8227990..8228724 1..737 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:07:55 Download gff for RH11830.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8227990..8228724 1..737 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:07:55 Download gff for RH11830.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8227990..8228724 1..737 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 14:24:31 Download gff for RH11830.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4115495..4116229 1..737 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:26:32 Download gff for RH11830.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8229189..8229923 1..737 99   Minus

RH11830.hyp Sequence

Translation from 111 to 527

> RH11830.hyp
MPGNLFQVLLTVAILPAISLASSSEDGLHHYRASPKLTGPVKLLHDPEDT
ILNTLDGALEKISTIYMQALFAGTHTPELEAPLRALEIELFDLLDELYNQ
NRLKDYIKYEAEVTRQMIIYNMLKRLFGYTQENEAGSV*

RH11830.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:23:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG34217-PA 138 CG34217-PA 1..138 1..138 699 100 Plus

RH11830.pep Sequence

Translation from 111 to 527

> RH11830.pep
MPGNLFQVLLTVAILPAISLASSSEDGLHHYRASPKLTGPVKLLHDPEDT
ILNTLDGALEKISTIYMQALFAGTHTPELEAPLRALEIELFDLLDELYNQ
NRLKDYIKYEAEVTRQMIIYNMLKRLFGYTQENEAGSV*

RH11830.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 19:45:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12603-PA 140 GF12603-PA 20..132 21..133 488 79.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 19:45:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10663-PA 134 GG10663-PA 1..134 5..138 652 93.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 19:45:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20826-PA 122 GH20826-PA 14..119 29..134 392 70.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:13:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG34217-PA 138 CG34217-PA 1..138 1..138 699 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 19:45:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20926-PA 130 GI20926-PA 24..128 30..134 318 68.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 19:45:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10879-PA 141 GL10879-PA 8..137 6..135 533 76.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 19:45:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24521-PA 141 GA24521-PA 8..138 6..136 534 76.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:45:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20708-PA 138 GM20708-PA 1..138 1..138 685 94.2 Plus
Dsec\GM20709-PA 138 GM20709-PA 1..138 1..138 685 94.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:45:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15289-PA 138 GD15289-PA 1..138 1..138 659 90.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 19:45:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20654-PA 134 GJ20654-PA 27..131 31..134 408 72.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 19:45:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15771-PA 136 GK15771-PA 19..135 22..134 432 71.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 19:45:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23207-PA 111 GE23207-PA 1..111 28..138 560 95.5 Plus