Clone RH12290 Report

Search the DGRC for RH12290

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:122
Well:90
Vector:pFlc-1
Associated Gene/TranscriptCG9691-RA
Protein status:RH12290.pep: gold
Preliminary Size:505
Sequenced Size:549

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9691 2002-01-01 Sim4 clustering to Release 2
CG9691 2002-04-22 Blastp of sequenced clone
CG9691 2003-01-01 Sim4 clustering to Release 3
CG9691 2008-04-29 Release 5.5 accounting
CG9691 2008-08-15 Release 5.9 accounting
CG9691 2008-12-18 5.12 accounting

Clone Sequence Records

RH12290.complete Sequence

549 bp (549 high quality bases) assembled on 2002-04-22

GenBank Submission: AY113568

> RH12290.complete
GGACCGCCGTCTCGGAGCGGAGCGATCAGTCAGTCGCGTTGTCAAGCTGA
AAGCGTAAAGATGAAATCGCTCGTTGTGTGCTCTTTGATCGGATTGGTCC
TGCTTATGGCCGCTGGCCAAGTTCGTGCCGAGTGCGACGAGGCCAAGAGT
CCCGAGGACAGCGAATTCAAGCACTTCTTCAAGAACCTAGGCTGCAAGGT
CAACCAGGGGGCCAAGGAGGTGGCCGAGGCCGCCAAGCCCTACACCGACA
AGATCGGCGAGGGCGCCAAGGAGTTTGGCAGCTCGGTGGCCCAGAAGTAC
GACGAACTGAAGCACAAGCTGACCGATGAGCCATCGACCACGCCCAAAAT
TCCAGTGGCCTATGACGCCCCCACCGAGAAGGTCCTTTTAGCCCCCATCG
GAGGACCCAGCACCCCGATCCCATGAGGGATTTTGCAATCGCTTGAAGGT
CCCCTCCGTCTCGTTGCATAAGTTTTCTTTGTTTTTTTTTTTTTCTTTGT
GATCTATATTAATAAAAACTAAAGTGATGTTGGAAAAAAAAAAAAAAAA

RH12290.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:33:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG9691-RA 674 CG9691-RA 111..645 2..535 2635 99.8 Plus
CG9691-RB 605 CG9691-RB 2..428 2..428 2135 100 Plus
CG9691-RB 605 CG9691-RB 495..605 426..535 515 99 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:26:30
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 9776149..9776575 2..428 2120 99.8 Plus
chrX 22417052 chrX 9776642..9776751 426..533 485 98.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:22:14 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:26:29
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 9884443..9884869 2..428 2135 100 Plus
X 23542271 X 9884936..9885046 426..535 505 99.1 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:23:38
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 9892541..9892967 2..428 2135 100 Plus
X 23527363 X 9893034..9893144 426..535 515 99 Plus
Blast to na_te.dros performed 2019-03-16 15:26:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dhet\Uhu 1658 Dhet\Uhu DHUHUH3 1658bp AKA(S51651) Derived from X63028 (Rel. 36, Last updated, Version 7). 1459..1531 464..531 110 65.8 Plus

RH12290.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:27:13 Download gff for RH12290.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 9776148..9776574 1..427 99 -> Plus
chrX 9776644..9776751 428..533 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:41:30 Download gff for RH12290.complete
Subject Subject Range Query Range Percent Splice Strand
CG9691-RA 1..366 61..426 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:56:40 Download gff for RH12290.complete
Subject Subject Range Query Range Percent Splice Strand
CG9691-RA 1..366 61..426 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:10:43 Download gff for RH12290.complete
Subject Subject Range Query Range Percent Splice Strand
CG9691-RB 1..366 61..426 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:37:25 Download gff for RH12290.complete
Subject Subject Range Query Range Percent Splice Strand
CG9691-RA 1..366 61..426 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:41:58 Download gff for RH12290.complete
Subject Subject Range Query Range Percent Splice Strand
CG9691-RB 1..366 61..426 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:35:02 Download gff for RH12290.complete
Subject Subject Range Query Range Percent Splice Strand
CG9691-RA 2..534 2..533 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:56:40 Download gff for RH12290.complete
Subject Subject Range Query Range Percent Splice Strand
CG9691-RA 2..534 2..533 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:10:43 Download gff for RH12290.complete
Subject Subject Range Query Range Percent Splice Strand
CG9691-RA 2..534 2..533 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:37:25 Download gff for RH12290.complete
Subject Subject Range Query Range Percent Splice Strand
CG9691-RA 2..534 2..533 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:41:58 Download gff for RH12290.complete
Subject Subject Range Query Range Percent Splice Strand
CG9691-RA 2..534 2..533 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:27:13 Download gff for RH12290.complete
Subject Subject Range Query Range Percent Splice Strand
X 9884442..9884868 1..427 99 -> Plus
X 9884938..9885044 428..533 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:27:13 Download gff for RH12290.complete
Subject Subject Range Query Range Percent Splice Strand
X 9884442..9884868 1..427 99 -> Plus
X 9884938..9885044 428..533 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:27:13 Download gff for RH12290.complete
Subject Subject Range Query Range Percent Splice Strand
X 9884442..9884868 1..427 99 -> Plus
X 9884938..9885044 428..533 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:10:43 Download gff for RH12290.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 9778475..9778901 1..427 99 -> Plus
arm_X 9778971..9779077 428..533 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:16:02 Download gff for RH12290.complete
Subject Subject Range Query Range Percent Splice Strand
X 9892540..9892966 1..427 99 -> Plus
X 9893036..9893142 428..533 99   Plus

RH12290.hyp Sequence

Translation from 0 to 425

> RH12290.hyp
RPPSRSGAISQSRCQAESVKMKSLVVCSLIGLVLLMAAGQVRAECDEAKS
PEDSEFKHFFKNLGCKVNQGAKEVAEAAKPYTDKIGEGAKEFGSSVAQKY
DELKHKLTDEPSTTPKIPVAYDAPTEKVLLAPIGGPSTPIP*

RH12290.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:39:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG9691-PA 121 CG9691-PA 1..121 21..141 625 100 Plus
CG9691-PB 121 CG9691-PB 1..121 21..141 625 100 Plus

RH12290.pep Sequence

Translation from 60 to 425

> RH12290.pep
MKSLVVCSLIGLVLLMAAGQVRAECDEAKSPEDSEFKHFFKNLGCKVNQG
AKEVAEAAKPYTDKIGEGAKEFGSSVAQKYDELKHKLTDEPSTTPKIPVA
YDAPTEKVLLAPIGGPSTPIP*

RH12290.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 22:44:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19140-PA 124 GF19140-PA 25..111 22..108 334 72.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 22:44:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18331-PA 121 GG18331-PA 1..121 1..121 603 95.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 22:44:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11809-PA 138 GH11809-PA 1..115 1..119 360 65.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:25:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG9691-PA 121 CG9691-PA 1..121 1..121 625 100 Plus
CG9691-PB 121 CG9691-PB 1..121 1..121 625 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 22:44:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15992-PA 131 GI15992-PA 17..119 18..119 338 67.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 22:44:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16381-PA 123 GL16381-PA 1..120 1..119 409 68.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 22:44:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21967-PA 123 GA21967-PA 1..120 1..119 409 68.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 22:44:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11397-PA 121 GM11397-PA 1..121 1..121 607 95.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 22:44:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24780-PA 102 GD24780-PA 44..102 63..121 292 94.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 22:44:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18720-PA 131 GJ18720-PA 1..119 1..119 367 62.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 22:44:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25363-PA 127 GK25363-PA 1..119 1..121 402 60.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 22:44:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17818-PA 121 GE17818-PA 1..121 1..121 612 96.7 Plus