Clone RH14104 Report

Search the DGRC for RH14104

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:141
Well:4
Vector:pFlc-1
Associated Gene/TranscriptCcp84Aa-RA
Protein status:RH14104.pep: gold
Preliminary Size:630
Sequenced Size:782

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG2360 2002-01-01 Sim4 clustering to Release 2
CG2360 2002-06-07 Blastp of sequenced clone
CG2360 2003-01-01 Sim4 clustering to Release 3
Ccp84Aa 2008-04-29 Release 5.5 accounting
Ccp84Aa 2008-08-15 Release 5.9 accounting
Ccp84Aa 2008-12-18 5.12 accounting

Clone Sequence Records

RH14104.complete Sequence

782 bp (782 high quality bases) assembled on 2002-06-07

GenBank Submission: BT011017

> RH14104.complete
GATCATTCAGCCATCAGCACCGTTTCCGCAAAGAACTAACCCACGAATCC
AAAAACCCTATAAAATGGCATTCAAGTTTGTCTTCGCCCTCGCCTTCGTC
GCCGTGGCCAGCGCCGGTTATGCCCCCATCGCCGCCCCACAGGTGTACCA
CGCTGCCCCAGCGGTGGCCACCTACGCCCACGCCCCCGTGGCCGTCGCCC
AGAAGGTCGTGGTCAAGGCCGCCGAGGAGTACGACCCCCACCCCCAGTAC
CGCTTCTCCTACGGAGTCGATGACAAGCTAACCGGTGACAACAAGGGACA
GGTGGAGGAGCGCGATGGAGATGTGGTACGCGGAGAGTACTCCCTGATCG
ACGCTGACGGCTACAAGAGGATCGTCCAGTACACCGCCGATCCCATCAAC
GGATTCAACGCCGTTGTCAACCGTGAGCCCCTGGTCAAGGCCGTCGCCGT
TGCCCCCGTTGTGAAGACCGTCGCCGCTCCCGTTGCCCAATACGCCGCCC
CTGCTGTCGCCCACTACGCTGCTCCCGCTGTGGTCAAGACCGTGGCTCCA
GTTGCCCACTACGCTGCTCCTGCTGTGGTCAAGACTGTGGCCCCAGTGGC
TCACTATGCTGCCCCCGCTGCATATGCCACCTATGCTGCTCCCACCCACT
ACGCCGCCCCCGCTGTTGCCTACCACCCCTGAGAACTGACATTCCACATT
GCCCAGCTCTTTATTGTTATAGTTTTACGAACGACTTCTATATATATAAA
AATATATTTCACATTTAAAAAAAAAAAAAAAA

RH14104.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:51:14
Subject Length Description Subject Range Query Range Score Percent Strand
Ccp84Aa-RA 832 Ccp84Aa-RA 66..832 2..768 3835 100 Plus
Ccp84Ab-RA 853 Ccp84Ab-RA 59..657 65..663 2875 98.6 Plus
Ccp84Ad-RA 862 Ccp84Ad-RA 406..743 282..619 1315 92.6 Plus
Ccp84Ad-RA 862 Ccp84Ad-RA 258..374 140..250 245 82 Plus
Ccp84Ad-RA 862 Ccp84Ad-RA 755..834 649..728 220 85 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 14:33:44
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 2530003..2530694 75..766 3460 100 Plus
chr3R 27901430 chr3R 2527936..2528524 663..75 2855 99 Minus
chr3R 27901430 chr3R 2518722..2519207 140..619 1480 87.4 Plus
chr3R 27901430 chr3R 2515553..2515853 434..140 465 77.7 Minus
chrX 22417052 chrX 5697335..5697587 192..444 395 77.1 Plus
chr3R 27901430 chr3R 2517045..2517205 432..272 385 82.6 Minus
chr3R 27901430 chr3R 2529875..2529949 2..76 375 100 Plus
chr3R 27901430 chr3R 2519142..2519207 509..574 300 97 Plus
chr3R 27901430 chr3R 2512975..2513111 299..435 235 78.1 Plus
chr3R 27901430 chr3R 2527979..2528045 575..509 215 88.1 Minus
chr3R 27901430 chr3R 2530437..2530503 554..620 215 88.1 Plus
chr3R 27901430 chr3R 2530482..2530548 509..575 215 88.1 Plus
chr3R 27901430 chr3R 2528024..2528090 620..554 200 86.6 Minus
chr3R 27901430 chr3R 2519097..2519161 554..618 190 86.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:22:38 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 14:33:42
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 6704212..6704908 75..771 3485 100 Plus
3R 32079331 3R 6702145..6702733 663..75 2840 98.8 Minus
3R 32079331 3R 6692928..6693413 140..619 1480 87.4 Plus
3R 32079331 3R 6689759..6690059 434..140 465 77.7 Minus
X 23542271 X 5804927..5805179 192..444 395 77.1 Plus
3R 32079331 3R 6691251..6691411 432..272 385 82.6 Minus
3R 32079331 3R 6704084..6704158 2..76 375 100 Plus
3R 32079331 3R 6693348..6693413 509..574 300 97 Plus
3R 32079331 3R 6687163..6687299 299..435 235 78.1 Plus
3R 32079331 3R 6702188..6702254 575..509 215 88.1 Minus
3R 32079331 3R 6704646..6704712 554..620 215 88.1 Plus
3R 32079331 3R 6704691..6704757 509..575 215 88.1 Plus
3R 32079331 3R 6702233..6702299 620..554 200 86.6 Minus
3R 32079331 3R 6693303..6693367 554..618 190 86.2 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:23:40
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 6445043..6445739 75..771 3485 100 Plus
3R 31820162 3R 6442976..6443564 663..75 2840 98.8 Minus
3R 31820162 3R 6433907..6434244 282..619 1315 92.6 Plus
3R 31820162 3R 6430590..6430890 434..140 475 77.7 Minus
3R 31820162 3R 6432082..6432242 432..272 385 82.6 Minus
3R 31820162 3R 6444915..6444989 2..76 375 100 Plus
X 23527363 X 5813125..5813277 292..444 360 82.3 Plus
3R 31820162 3R 6433759..6433875 140..250 245 82 Plus
3R 31820162 3R 6434256..6434335 649..728 220 85 Plus
3R 31820162 3R 6428075..6428130 380..435 205 91 Plus
Blast to na_te.dros performed 2019-03-15 14:33:42
Subject Length Description Subject Range Query Range Score Percent Strand
R1A1-element 5356 R1A1-element DMRER1DM 5356bp Derived from X51968 (g8429) (Rel. 23, Last updated, Version 1). 600..640 625..668 122 81.8 Plus
R1A1-element 5356 R1A1-element DMRER1DM 5356bp Derived from X51968 (g8429) (Rel. 23, Last updated, Version 1). 601..647 599..645 109 70.2 Plus

RH14104.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 14:34:37 Download gff for RH14104.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 2529873..2529949 1..76 98 -> Plus
chr3R 2530005..2530662 77..734 100 <- Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:41:50 Download gff for RH14104.complete
Subject Subject Range Query Range Percent Splice Strand
Ccp84Aa-RA 1..618 65..682 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:27:11 Download gff for RH14104.complete
Subject Subject Range Query Range Percent Splice Strand
Ccp84Aa-RA 1..618 65..682 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:34:41 Download gff for RH14104.complete
Subject Subject Range Query Range Percent Splice Strand
Ccp84Aa-RA 1..618 65..682 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:18:02 Download gff for RH14104.complete
Subject Subject Range Query Range Percent Splice Strand
Ccp84Aa-RA 1..618 65..682 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:02:54 Download gff for RH14104.complete
Subject Subject Range Query Range Percent Splice Strand
Ccp84Aa-RA 1..618 65..682 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:56:12 Download gff for RH14104.complete
Subject Subject Range Query Range Percent Splice Strand
Ccp84Aa-RA 1..767 1..766 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:27:11 Download gff for RH14104.complete
Subject Subject Range Query Range Percent Splice Strand
Ccp84Aa-RA 1..767 1..766 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:34:41 Download gff for RH14104.complete
Subject Subject Range Query Range Percent Splice Strand
Ccp84Aa-RA 1..765 2..766 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:18:02 Download gff for RH14104.complete
Subject Subject Range Query Range Percent Splice Strand
Ccp84Aa-RA 1..767 1..766 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:02:54 Download gff for RH14104.complete
Subject Subject Range Query Range Percent Splice Strand
Ccp84Aa-RA 1..765 2..766 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:34:37 Download gff for RH14104.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6704082..6704158 1..76 98 -> Plus
3R 6704214..6704903 77..766 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:34:37 Download gff for RH14104.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6704082..6704158 1..76 98 -> Plus
3R 6704214..6704903 77..766 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:34:37 Download gff for RH14104.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6704082..6704158 1..76 98 -> Plus
3R 6704214..6704903 77..766 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:34:41 Download gff for RH14104.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 2529804..2529880 1..76 98 -> Plus
arm_3R 2529936..2530625 77..766 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:51:02 Download gff for RH14104.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6445045..6445734 77..766 100   Plus
3R 6444913..6444989 1..76 98 -> Plus

RH14104.hyp Sequence

Translation from 0 to 681

> RH14104.hyp
IIQPSAPFPQRTNPRIQKPYKMAFKFVFALAFVAVASAGYAPIAAPQVYH
AAPAVATYAHAPVAVAQKVVVKAAEEYDPHPQYRFSYGVDDKLTGDNKGQ
VEERDGDVVRGEYSLIDADGYKRIVQYTADPINGFNAVVNREPLVKAVAV
APVVKTVAAPVAQYAAPAVAHYAAPAVVKTVAPVAHYAAPAVVKTVAPVA
HYAAPAAYATYAAPTHYAAPAVAYHP*

RH14104.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:13:10
Subject Length Description Subject Range Query Range Score Percent Strand
Ccp84Aa-PA 205 CG2360-PA 1..205 22..226 1050 100 Plus
Ccp84Ab-PA 221 CG1252-PA 1..200 22..221 1015 99.5 Plus
Ccp84Ad-PA 199 CG2341-PA 1..198 22..225 824 81.6 Plus
Ccp84Af-PA 151 CG1331-PA 1..147 22..172 491 69.3 Plus
Cpr5C-PA 145 CG4052-PA 1..142 22..166 459 65.8 Plus

RH14104.pep Sequence

Translation from 64 to 681

> RH14104.pep
MAFKFVFALAFVAVASAGYAPIAAPQVYHAAPAVATYAHAPVAVAQKVVV
KAAEEYDPHPQYRFSYGVDDKLTGDNKGQVEERDGDVVRGEYSLIDADGY
KRIVQYTADPINGFNAVVNREPLVKAVAVAPVVKTVAAPVAQYAAPAVAH
YAAPAVVKTVAPVAHYAAPAVVKTVAPVAHYAAPAAYATYAAPTHYAAPA
VAYHP*

RH14104.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 06:33:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17799-PA 210 GF17799-PA 1..209 1..204 648 84.3 Plus
Dana\GF17187-PA 217 GF17187-PA 1..216 1..204 554 80.9 Plus
Dana\GF17186-PA 221 GF17186-PA 1..220 1..204 535 65.1 Plus
Dana\GF21210-PA 141 GF21210-PA 1..133 1..131 398 65.9 Plus
Dana\GF17801-PA 217 GF17801-PA 1..130 1..142 362 56.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 06:33:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13642-PA 220 GG13642-PA 1..219 1..204 929 91.3 Plus
Dere\GG10280-PA 230 GG10280-PA 1..218 1..203 919 90.8 Plus
Dere\GG13631-PA 199 GG13631-PA 1..198 1..204 563 82.5 Plus
Dere\GG10313-PA 151 GG10313-PA 1..123 1..123 431 74.4 Plus
Dere\GG18788-PA 145 GG18788-PA 1..136 1..132 362 65.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 06:33:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19485-PA 227 GH19485-PA 1..188 1..193 614 77.3 Plus
Dgri\GH18129-PA 227 GH18129-PA 1..188 1..193 601 75.9 Plus
Dgri\GH18128-PA 166 GH18128-PA 1..163 1..172 451 66.5 Plus
Dgri\GH19487-PA 201 GH19487-PA 1..192 1..162 443 65.1 Plus
Dgri\GH19489-PA 147 GH19489-PA 1..136 1..138 377 65.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:19:27
Subject Length Description Subject Range Query Range Score Percent Strand
Ccp84Aa-PA 205 CG2360-PA 1..205 1..205 1050 100 Plus
Ccp84Ab-PA 221 CG1252-PA 1..200 1..200 1015 99.5 Plus
Ccp84Ad-PA 199 CG2341-PA 1..198 1..204 824 81.6 Plus
Ccp84Af-PA 151 CG1331-PA 1..147 1..151 491 69.3 Plus
Cpr5C-PA 145 CG4052-PA 1..142 1..145 459 65.8 Plus
Ccp84Ae-PA 208 CG1330-PA 1..202 1..200 423 52.1 Plus
Ccp84Ag-PA 191 CG2342-PA 1..175 1..205 409 52.2 Plus
Cpr64Ad-PB 247 CG1259-PB 85..242 3..161 339 52.8 Plus
Ccp84Ac-PA 217 CG1327-PA 1..206 1..198 336 42.7 Plus
Cpr64Aa-PA 192 CG15006-PA 1..176 1..177 332 48.1 Plus
Cpr31A-PA 340 CG33302-PA 76..248 7..176 324 46.4 Plus
Cpr62Bb-PC 194 CG13935-PC 16..157 40..196 309 52.8 Plus
Cpr62Bb-PB 194 CG13935-PB 16..157 40..196 309 52.8 Plus
Cpr62Bb-PA 194 CG13935-PA 16..157 40..196 309 52.8 Plus
Edg84A-PA 188 CG2345-PA 29..181 54..205 308 45.3 Plus
Cpr62Bc-PB 180 CG1919-PB 4..178 3..197 306 40.8 Plus
Cpr62Bc-PA 180 CG1919-PA 4..178 3..197 306 40.8 Plus
Cpr92A-PA 245 CG6240-PA 9..236 13..205 302 39.8 Plus
Cpr64Ab-PA 120 CG15007-PA 14..118 34..140 285 57 Plus
Cpr64Ac-PA 188 CG15008-PA 39..182 9..156 269 46.1 Plus
CG34461-PB 138 CG34461-PB 4..138 11..151 264 48.6 Plus
CG34461-PA 138 CG34461-PA 4..138 11..151 264 48.6 Plus
Cpr30F-PA 146 CG31876-PA 1..137 6..162 247 40.5 Plus
Crys-PB 477 CG16963-PB 69..138 54..123 238 60 Plus
Crys-PA 477 CG16963-PA 69..138 54..123 238 60 Plus
Cpr23B-PA 302 CG2973-PA 136..233 41..146 230 50 Plus
Cpr76Bd-PD 1228 CG9299-PD 1106..1220 19..128 228 49.6 Plus
Cpr76Bd-PB 1228 CG9299-PB 1106..1220 19..128 228 49.6 Plus
Cpr76Bd-PC 1231 CG9299-PC 1109..1223 19..128 228 49.6 Plus
Cpr30B-PA 153 CG3818-PA 20..143 48..183 224 40.6 Plus
CG42367-PC 103 CG42367-PC 3..100 27..123 212 45.9 Plus
Cpr76Bb-PA 198 CG9290-PA 59..144 37..120 208 48.8 Plus
Cpr35B-PA 218 CG3474-PA 1..133 1..123 204 40.7 Plus
Cpr66Cb-PA 162 CG7076-PA 82..147 55..120 194 57.6 Plus
Cpr76Ba-PA 204 CG9283-PA 92..156 54..118 188 58.5 Plus
Cpr76Bc-PD 424 CG9295-PD 46..112 55..118 178 56.7 Plus
Cpr76Bc-PC 424 CG9295-PC 46..112 55..118 178 56.7 Plus
CG13670-PA 266 CG13670-PA 96..159 55..118 163 50 Plus
Cpr66D-PA 270 CG32029-PA 149..218 54..122 161 47.1 Plus
CG34205-PA 217 CG34205-PA 58..153 122..203 154 41.7 Plus
CG34205-PA 217 CG34205-PA 22..207 2..193 152 32.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 06:33:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23843-PA 227 GI23843-PA 1..187 1..203 590 76.1 Plus
Dmoj\GI23755-PA 191 GI23755-PA 1..190 1..204 526 70.9 Plus
Dmoj\GI23842-PA 176 GI23842-PA 1..174 1..187 515 68 Plus
Dmoj\GI23757-PA 176 GI23757-PA 1..174 1..187 505 67.5 Plus
Dmoj\GI23758-PA 189 GI23758-PA 1..111 1..124 333 58.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 06:33:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21772-PA 223 GL21772-PA 4..204 26..203 562 72.9 Plus
Dper\GL21770-PA 213 GL21770-PA 1..212 1..204 542 67.3 Plus
Dper\GL22048-PA 315 GL22048-PA 1..121 1..123 496 83.9 Plus
Dper\GL22052-PA 151 GL22052-PA 1..123 1..123 379 68 Plus
Dper\GL22051-PA 217 GL22051-PA 44..123 54..134 331 72.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 06:33:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26397-PA 242 GA26397-PA 1..200 1..200 704 83.9 Plus
Dpse\GA27359-PA 211 GA27359-PA 1..210 1..204 612 76.1 Plus
Dpse\GA26395-PA 213 GA26395-PA 1..212 1..204 516 68.2 Plus
Dpse\GA27360-PA 151 GA27360-PA 1..123 1..123 379 68 Plus
Dpse\GA12183-PB 217 GA12183-PB 44..123 54..134 331 72.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 06:33:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10912-PA 211 GM10912-PA 1..210 1..204 948 96.2 Plus
Dsec\GM10531-PA 236 GM10531-PA 1..235 1..204 684 84.7 Plus
Dsec\GM10911-PA 199 GM10911-PA 1..198 1..204 557 82 Plus
Dsec\GM10535-PA 151 GM10535-PA 1..123 1..123 430 74.4 Plus
Dsec\GM12439-PA 145 GM12439-PA 1..137 1..141 380 66.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 06:33:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19526-PA 236 GD19526-PA 1..235 1..204 908 84.7 Plus
Dsim\GD19891-PA 193 GD19891-PA 1..192 1..204 548 77.7 Plus
Dsim\GD19531-PA 151 GD19531-PA 1..123 1..123 430 74.4 Plus
Dsim\GD16755-PA 145 GD16755-PA 1..137 1..141 397 66.9 Plus
Dsim\GD19892-PA 76 GD19892-PA 1..73 1..73 354 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 06:33:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23938-PA 233 GJ23938-PA 1..232 1..204 599 68 Plus
Dvir\GJ23302-PA 256 GJ23302-PA 1..232 1..200 587 68.9 Plus
Dvir\GJ23301-PA 175 GJ23301-PA 1..146 1..141 434 73 Plus
Dvir\GJ23940-PA 200 GJ23940-PA 1..192 1..193 421 62.9 Plus
Dvir\GJ23942-PA 183 GJ23942-PA 1..177 1..200 347 49 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 06:33:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12249-PA 228 GK12249-PA 1..187 1..200 630 71.6 Plus
Dwil\GK10832-PA 179 GK10832-PA 1..178 1..204 603 68.4 Plus
Dwil\GK10834-PA 219 GK10834-PA 1..184 1..180 385 67 Plus
Dwil\GK12248-PA 219 GK12248-PA 1..184 1..180 385 67 Plus
Dwil\GK12247-PA 194 GK12247-PA 1..103 1..123 304 54 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 06:33:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25835-PA 212 GE25835-PA 1..191 1..200 871 94 Plus
Dyak\GE24881-PA 228 GE24881-PA 1..197 1..189 610 92.9 Plus
Dyak\GE24880-PA 181 GE24880-PA 1..179 1..185 464 79.1 Plus
Dyak\GE25838-PA 151 GE25838-PA 1..123 1..123 426 73.6 Plus
Dyak\GE16433-PA 154 GE16433-PA 1..135 1..127 410 69.6 Plus