BDGP Sequence Production Resources |
Search the DGRC for RH14104
Library: | RH |
Tissue Source: | Drosophila melanogaster adult head |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2001-04-30 |
Comments: | Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 141 |
Well: | 4 |
Vector: | pFlc-1 |
Associated Gene/Transcript | Ccp84Aa-RA |
Protein status: | RH14104.pep: gold |
Preliminary Size: | 630 |
Sequenced Size: | 782 |
Gene | Date | Evidence |
---|---|---|
CG2360 | 2002-01-01 | Sim4 clustering to Release 2 |
CG2360 | 2002-06-07 | Blastp of sequenced clone |
CG2360 | 2003-01-01 | Sim4 clustering to Release 3 |
Ccp84Aa | 2008-04-29 | Release 5.5 accounting |
Ccp84Aa | 2008-08-15 | Release 5.9 accounting |
Ccp84Aa | 2008-12-18 | 5.12 accounting |
782 bp (782 high quality bases) assembled on 2002-06-07
GenBank Submission: BT011017
> RH14104.complete GATCATTCAGCCATCAGCACCGTTTCCGCAAAGAACTAACCCACGAATCC AAAAACCCTATAAAATGGCATTCAAGTTTGTCTTCGCCCTCGCCTTCGTC GCCGTGGCCAGCGCCGGTTATGCCCCCATCGCCGCCCCACAGGTGTACCA CGCTGCCCCAGCGGTGGCCACCTACGCCCACGCCCCCGTGGCCGTCGCCC AGAAGGTCGTGGTCAAGGCCGCCGAGGAGTACGACCCCCACCCCCAGTAC CGCTTCTCCTACGGAGTCGATGACAAGCTAACCGGTGACAACAAGGGACA GGTGGAGGAGCGCGATGGAGATGTGGTACGCGGAGAGTACTCCCTGATCG ACGCTGACGGCTACAAGAGGATCGTCCAGTACACCGCCGATCCCATCAAC GGATTCAACGCCGTTGTCAACCGTGAGCCCCTGGTCAAGGCCGTCGCCGT TGCCCCCGTTGTGAAGACCGTCGCCGCTCCCGTTGCCCAATACGCCGCCC CTGCTGTCGCCCACTACGCTGCTCCCGCTGTGGTCAAGACCGTGGCTCCA GTTGCCCACTACGCTGCTCCTGCTGTGGTCAAGACTGTGGCCCCAGTGGC TCACTATGCTGCCCCCGCTGCATATGCCACCTATGCTGCTCCCACCCACT ACGCCGCCCCCGCTGTTGCCTACCACCCCTGAGAACTGACATTCCACATT GCCCAGCTCTTTATTGTTATAGTTTTACGAACGACTTCTATATATATAAA AATATATTTCACATTTAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Ccp84Aa-RA | 832 | Ccp84Aa-RA | 66..832 | 2..768 | 3835 | 100 | Plus |
Ccp84Ab-RA | 853 | Ccp84Ab-RA | 59..657 | 65..663 | 2875 | 98.6 | Plus |
Ccp84Ad-RA | 862 | Ccp84Ad-RA | 406..743 | 282..619 | 1315 | 92.6 | Plus |
Ccp84Ad-RA | 862 | Ccp84Ad-RA | 258..374 | 140..250 | 245 | 82 | Plus |
Ccp84Ad-RA | 862 | Ccp84Ad-RA | 755..834 | 649..728 | 220 | 85 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 2530003..2530694 | 75..766 | 3460 | 100 | Plus |
chr3R | 27901430 | chr3R | 2527936..2528524 | 663..75 | 2855 | 99 | Minus |
chr3R | 27901430 | chr3R | 2518722..2519207 | 140..619 | 1480 | 87.4 | Plus |
chr3R | 27901430 | chr3R | 2515553..2515853 | 434..140 | 465 | 77.7 | Minus |
chrX | 22417052 | chrX | 5697335..5697587 | 192..444 | 395 | 77.1 | Plus |
chr3R | 27901430 | chr3R | 2517045..2517205 | 432..272 | 385 | 82.6 | Minus |
chr3R | 27901430 | chr3R | 2529875..2529949 | 2..76 | 375 | 100 | Plus |
chr3R | 27901430 | chr3R | 2519142..2519207 | 509..574 | 300 | 97 | Plus |
chr3R | 27901430 | chr3R | 2512975..2513111 | 299..435 | 235 | 78.1 | Plus |
chr3R | 27901430 | chr3R | 2527979..2528045 | 575..509 | 215 | 88.1 | Minus |
chr3R | 27901430 | chr3R | 2530437..2530503 | 554..620 | 215 | 88.1 | Plus |
chr3R | 27901430 | chr3R | 2530482..2530548 | 509..575 | 215 | 88.1 | Plus |
chr3R | 27901430 | chr3R | 2528024..2528090 | 620..554 | 200 | 86.6 | Minus |
chr3R | 27901430 | chr3R | 2519097..2519161 | 554..618 | 190 | 86.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 6704212..6704908 | 75..771 | 3485 | 100 | Plus |
3R | 32079331 | 3R | 6702145..6702733 | 663..75 | 2840 | 98.8 | Minus |
3R | 32079331 | 3R | 6692928..6693413 | 140..619 | 1480 | 87.4 | Plus |
3R | 32079331 | 3R | 6689759..6690059 | 434..140 | 465 | 77.7 | Minus |
X | 23542271 | X | 5804927..5805179 | 192..444 | 395 | 77.1 | Plus |
3R | 32079331 | 3R | 6691251..6691411 | 432..272 | 385 | 82.6 | Minus |
3R | 32079331 | 3R | 6704084..6704158 | 2..76 | 375 | 100 | Plus |
3R | 32079331 | 3R | 6693348..6693413 | 509..574 | 300 | 97 | Plus |
3R | 32079331 | 3R | 6687163..6687299 | 299..435 | 235 | 78.1 | Plus |
3R | 32079331 | 3R | 6702188..6702254 | 575..509 | 215 | 88.1 | Minus |
3R | 32079331 | 3R | 6704646..6704712 | 554..620 | 215 | 88.1 | Plus |
3R | 32079331 | 3R | 6704691..6704757 | 509..575 | 215 | 88.1 | Plus |
3R | 32079331 | 3R | 6702233..6702299 | 620..554 | 200 | 86.6 | Minus |
3R | 32079331 | 3R | 6693303..6693367 | 554..618 | 190 | 86.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 6445043..6445739 | 75..771 | 3485 | 100 | Plus |
3R | 31820162 | 3R | 6442976..6443564 | 663..75 | 2840 | 98.8 | Minus |
3R | 31820162 | 3R | 6433907..6434244 | 282..619 | 1315 | 92.6 | Plus |
3R | 31820162 | 3R | 6430590..6430890 | 434..140 | 475 | 77.7 | Minus |
3R | 31820162 | 3R | 6432082..6432242 | 432..272 | 385 | 82.6 | Minus |
3R | 31820162 | 3R | 6444915..6444989 | 2..76 | 375 | 100 | Plus |
X | 23527363 | X | 5813125..5813277 | 292..444 | 360 | 82.3 | Plus |
3R | 31820162 | 3R | 6433759..6433875 | 140..250 | 245 | 82 | Plus |
3R | 31820162 | 3R | 6434256..6434335 | 649..728 | 220 | 85 | Plus |
3R | 31820162 | 3R | 6428075..6428130 | 380..435 | 205 | 91 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
R1A1-element | 5356 | R1A1-element DMRER1DM 5356bp Derived from X51968 (g8429) (Rel. 23, Last updated, Version 1). | 600..640 | 625..668 | 122 | 81.8 | Plus |
R1A1-element | 5356 | R1A1-element DMRER1DM 5356bp Derived from X51968 (g8429) (Rel. 23, Last updated, Version 1). | 601..647 | 599..645 | 109 | 70.2 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 2529873..2529949 | 1..76 | 98 | -> | Plus |
chr3R | 2530005..2530662 | 77..734 | 100 | <- | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Ccp84Aa-RA | 1..618 | 65..682 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Ccp84Aa-RA | 1..618 | 65..682 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Ccp84Aa-RA | 1..618 | 65..682 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Ccp84Aa-RA | 1..618 | 65..682 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Ccp84Aa-RA | 1..618 | 65..682 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Ccp84Aa-RA | 1..767 | 1..766 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Ccp84Aa-RA | 1..767 | 1..766 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Ccp84Aa-RA | 1..765 | 2..766 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Ccp84Aa-RA | 1..767 | 1..766 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Ccp84Aa-RA | 1..765 | 2..766 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 6704082..6704158 | 1..76 | 98 | -> | Plus |
3R | 6704214..6704903 | 77..766 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 6704082..6704158 | 1..76 | 98 | -> | Plus |
3R | 6704214..6704903 | 77..766 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 6704082..6704158 | 1..76 | 98 | -> | Plus |
3R | 6704214..6704903 | 77..766 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 2529804..2529880 | 1..76 | 98 | -> | Plus |
arm_3R | 2529936..2530625 | 77..766 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 6445045..6445734 | 77..766 | 100 | Plus | |
3R | 6444913..6444989 | 1..76 | 98 | -> | Plus |
Translation from 0 to 681
> RH14104.hyp IIQPSAPFPQRTNPRIQKPYKMAFKFVFALAFVAVASAGYAPIAAPQVYH AAPAVATYAHAPVAVAQKVVVKAAEEYDPHPQYRFSYGVDDKLTGDNKGQ VEERDGDVVRGEYSLIDADGYKRIVQYTADPINGFNAVVNREPLVKAVAV APVVKTVAAPVAQYAAPAVAHYAAPAVVKTVAPVAHYAAPAVVKTVAPVA HYAAPAAYATYAAPTHYAAPAVAYHP*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Ccp84Aa-PA | 205 | CG2360-PA | 1..205 | 22..226 | 1050 | 100 | Plus |
Ccp84Ab-PA | 221 | CG1252-PA | 1..200 | 22..221 | 1015 | 99.5 | Plus |
Ccp84Ad-PA | 199 | CG2341-PA | 1..198 | 22..225 | 824 | 81.6 | Plus |
Ccp84Af-PA | 151 | CG1331-PA | 1..147 | 22..172 | 491 | 69.3 | Plus |
Cpr5C-PA | 145 | CG4052-PA | 1..142 | 22..166 | 459 | 65.8 | Plus |
Translation from 64 to 681
> RH14104.pep MAFKFVFALAFVAVASAGYAPIAAPQVYHAAPAVATYAHAPVAVAQKVVV KAAEEYDPHPQYRFSYGVDDKLTGDNKGQVEERDGDVVRGEYSLIDADGY KRIVQYTADPINGFNAVVNREPLVKAVAVAPVVKTVAAPVAQYAAPAVAH YAAPAVVKTVAPVAHYAAPAVVKTVAPVAHYAAPAAYATYAAPTHYAAPA VAYHP*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF17799-PA | 210 | GF17799-PA | 1..209 | 1..204 | 648 | 84.3 | Plus |
Dana\GF17187-PA | 217 | GF17187-PA | 1..216 | 1..204 | 554 | 80.9 | Plus |
Dana\GF17186-PA | 221 | GF17186-PA | 1..220 | 1..204 | 535 | 65.1 | Plus |
Dana\GF21210-PA | 141 | GF21210-PA | 1..133 | 1..131 | 398 | 65.9 | Plus |
Dana\GF17801-PA | 217 | GF17801-PA | 1..130 | 1..142 | 362 | 56.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG13642-PA | 220 | GG13642-PA | 1..219 | 1..204 | 929 | 91.3 | Plus |
Dere\GG10280-PA | 230 | GG10280-PA | 1..218 | 1..203 | 919 | 90.8 | Plus |
Dere\GG13631-PA | 199 | GG13631-PA | 1..198 | 1..204 | 563 | 82.5 | Plus |
Dere\GG10313-PA | 151 | GG10313-PA | 1..123 | 1..123 | 431 | 74.4 | Plus |
Dere\GG18788-PA | 145 | GG18788-PA | 1..136 | 1..132 | 362 | 65.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH19485-PA | 227 | GH19485-PA | 1..188 | 1..193 | 614 | 77.3 | Plus |
Dgri\GH18129-PA | 227 | GH18129-PA | 1..188 | 1..193 | 601 | 75.9 | Plus |
Dgri\GH18128-PA | 166 | GH18128-PA | 1..163 | 1..172 | 451 | 66.5 | Plus |
Dgri\GH19487-PA | 201 | GH19487-PA | 1..192 | 1..162 | 443 | 65.1 | Plus |
Dgri\GH19489-PA | 147 | GH19489-PA | 1..136 | 1..138 | 377 | 65.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Ccp84Aa-PA | 205 | CG2360-PA | 1..205 | 1..205 | 1050 | 100 | Plus |
Ccp84Ab-PA | 221 | CG1252-PA | 1..200 | 1..200 | 1015 | 99.5 | Plus |
Ccp84Ad-PA | 199 | CG2341-PA | 1..198 | 1..204 | 824 | 81.6 | Plus |
Ccp84Af-PA | 151 | CG1331-PA | 1..147 | 1..151 | 491 | 69.3 | Plus |
Cpr5C-PA | 145 | CG4052-PA | 1..142 | 1..145 | 459 | 65.8 | Plus |
Ccp84Ae-PA | 208 | CG1330-PA | 1..202 | 1..200 | 423 | 52.1 | Plus |
Ccp84Ag-PA | 191 | CG2342-PA | 1..175 | 1..205 | 409 | 52.2 | Plus |
Cpr64Ad-PB | 247 | CG1259-PB | 85..242 | 3..161 | 339 | 52.8 | Plus |
Ccp84Ac-PA | 217 | CG1327-PA | 1..206 | 1..198 | 336 | 42.7 | Plus |
Cpr64Aa-PA | 192 | CG15006-PA | 1..176 | 1..177 | 332 | 48.1 | Plus |
Cpr31A-PA | 340 | CG33302-PA | 76..248 | 7..176 | 324 | 46.4 | Plus |
Cpr62Bb-PC | 194 | CG13935-PC | 16..157 | 40..196 | 309 | 52.8 | Plus |
Cpr62Bb-PB | 194 | CG13935-PB | 16..157 | 40..196 | 309 | 52.8 | Plus |
Cpr62Bb-PA | 194 | CG13935-PA | 16..157 | 40..196 | 309 | 52.8 | Plus |
Edg84A-PA | 188 | CG2345-PA | 29..181 | 54..205 | 308 | 45.3 | Plus |
Cpr62Bc-PB | 180 | CG1919-PB | 4..178 | 3..197 | 306 | 40.8 | Plus |
Cpr62Bc-PA | 180 | CG1919-PA | 4..178 | 3..197 | 306 | 40.8 | Plus |
Cpr92A-PA | 245 | CG6240-PA | 9..236 | 13..205 | 302 | 39.8 | Plus |
Cpr64Ab-PA | 120 | CG15007-PA | 14..118 | 34..140 | 285 | 57 | Plus |
Cpr64Ac-PA | 188 | CG15008-PA | 39..182 | 9..156 | 269 | 46.1 | Plus |
CG34461-PB | 138 | CG34461-PB | 4..138 | 11..151 | 264 | 48.6 | Plus |
CG34461-PA | 138 | CG34461-PA | 4..138 | 11..151 | 264 | 48.6 | Plus |
Cpr30F-PA | 146 | CG31876-PA | 1..137 | 6..162 | 247 | 40.5 | Plus |
Crys-PB | 477 | CG16963-PB | 69..138 | 54..123 | 238 | 60 | Plus |
Crys-PA | 477 | CG16963-PA | 69..138 | 54..123 | 238 | 60 | Plus |
Cpr23B-PA | 302 | CG2973-PA | 136..233 | 41..146 | 230 | 50 | Plus |
Cpr76Bd-PD | 1228 | CG9299-PD | 1106..1220 | 19..128 | 228 | 49.6 | Plus |
Cpr76Bd-PB | 1228 | CG9299-PB | 1106..1220 | 19..128 | 228 | 49.6 | Plus |
Cpr76Bd-PC | 1231 | CG9299-PC | 1109..1223 | 19..128 | 228 | 49.6 | Plus |
Cpr30B-PA | 153 | CG3818-PA | 20..143 | 48..183 | 224 | 40.6 | Plus |
CG42367-PC | 103 | CG42367-PC | 3..100 | 27..123 | 212 | 45.9 | Plus |
Cpr76Bb-PA | 198 | CG9290-PA | 59..144 | 37..120 | 208 | 48.8 | Plus |
Cpr35B-PA | 218 | CG3474-PA | 1..133 | 1..123 | 204 | 40.7 | Plus |
Cpr66Cb-PA | 162 | CG7076-PA | 82..147 | 55..120 | 194 | 57.6 | Plus |
Cpr76Ba-PA | 204 | CG9283-PA | 92..156 | 54..118 | 188 | 58.5 | Plus |
Cpr76Bc-PD | 424 | CG9295-PD | 46..112 | 55..118 | 178 | 56.7 | Plus |
Cpr76Bc-PC | 424 | CG9295-PC | 46..112 | 55..118 | 178 | 56.7 | Plus |
CG13670-PA | 266 | CG13670-PA | 96..159 | 55..118 | 163 | 50 | Plus |
Cpr66D-PA | 270 | CG32029-PA | 149..218 | 54..122 | 161 | 47.1 | Plus |
CG34205-PA | 217 | CG34205-PA | 58..153 | 122..203 | 154 | 41.7 | Plus |
CG34205-PA | 217 | CG34205-PA | 22..207 | 2..193 | 152 | 32.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI23843-PA | 227 | GI23843-PA | 1..187 | 1..203 | 590 | 76.1 | Plus |
Dmoj\GI23755-PA | 191 | GI23755-PA | 1..190 | 1..204 | 526 | 70.9 | Plus |
Dmoj\GI23842-PA | 176 | GI23842-PA | 1..174 | 1..187 | 515 | 68 | Plus |
Dmoj\GI23757-PA | 176 | GI23757-PA | 1..174 | 1..187 | 505 | 67.5 | Plus |
Dmoj\GI23758-PA | 189 | GI23758-PA | 1..111 | 1..124 | 333 | 58.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL21772-PA | 223 | GL21772-PA | 4..204 | 26..203 | 562 | 72.9 | Plus |
Dper\GL21770-PA | 213 | GL21770-PA | 1..212 | 1..204 | 542 | 67.3 | Plus |
Dper\GL22048-PA | 315 | GL22048-PA | 1..121 | 1..123 | 496 | 83.9 | Plus |
Dper\GL22052-PA | 151 | GL22052-PA | 1..123 | 1..123 | 379 | 68 | Plus |
Dper\GL22051-PA | 217 | GL22051-PA | 44..123 | 54..134 | 331 | 72.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA26397-PA | 242 | GA26397-PA | 1..200 | 1..200 | 704 | 83.9 | Plus |
Dpse\GA27359-PA | 211 | GA27359-PA | 1..210 | 1..204 | 612 | 76.1 | Plus |
Dpse\GA26395-PA | 213 | GA26395-PA | 1..212 | 1..204 | 516 | 68.2 | Plus |
Dpse\GA27360-PA | 151 | GA27360-PA | 1..123 | 1..123 | 379 | 68 | Plus |
Dpse\GA12183-PB | 217 | GA12183-PB | 44..123 | 54..134 | 331 | 72.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM10912-PA | 211 | GM10912-PA | 1..210 | 1..204 | 948 | 96.2 | Plus |
Dsec\GM10531-PA | 236 | GM10531-PA | 1..235 | 1..204 | 684 | 84.7 | Plus |
Dsec\GM10911-PA | 199 | GM10911-PA | 1..198 | 1..204 | 557 | 82 | Plus |
Dsec\GM10535-PA | 151 | GM10535-PA | 1..123 | 1..123 | 430 | 74.4 | Plus |
Dsec\GM12439-PA | 145 | GM12439-PA | 1..137 | 1..141 | 380 | 66.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD19526-PA | 236 | GD19526-PA | 1..235 | 1..204 | 908 | 84.7 | Plus |
Dsim\GD19891-PA | 193 | GD19891-PA | 1..192 | 1..204 | 548 | 77.7 | Plus |
Dsim\GD19531-PA | 151 | GD19531-PA | 1..123 | 1..123 | 430 | 74.4 | Plus |
Dsim\GD16755-PA | 145 | GD16755-PA | 1..137 | 1..141 | 397 | 66.9 | Plus |
Dsim\GD19892-PA | 76 | GD19892-PA | 1..73 | 1..73 | 354 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ23938-PA | 233 | GJ23938-PA | 1..232 | 1..204 | 599 | 68 | Plus |
Dvir\GJ23302-PA | 256 | GJ23302-PA | 1..232 | 1..200 | 587 | 68.9 | Plus |
Dvir\GJ23301-PA | 175 | GJ23301-PA | 1..146 | 1..141 | 434 | 73 | Plus |
Dvir\GJ23940-PA | 200 | GJ23940-PA | 1..192 | 1..193 | 421 | 62.9 | Plus |
Dvir\GJ23942-PA | 183 | GJ23942-PA | 1..177 | 1..200 | 347 | 49 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK12249-PA | 228 | GK12249-PA | 1..187 | 1..200 | 630 | 71.6 | Plus |
Dwil\GK10832-PA | 179 | GK10832-PA | 1..178 | 1..204 | 603 | 68.4 | Plus |
Dwil\GK10834-PA | 219 | GK10834-PA | 1..184 | 1..180 | 385 | 67 | Plus |
Dwil\GK12248-PA | 219 | GK12248-PA | 1..184 | 1..180 | 385 | 67 | Plus |
Dwil\GK12247-PA | 194 | GK12247-PA | 1..103 | 1..123 | 304 | 54 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE25835-PA | 212 | GE25835-PA | 1..191 | 1..200 | 871 | 94 | Plus |
Dyak\GE24881-PA | 228 | GE24881-PA | 1..197 | 1..189 | 610 | 92.9 | Plus |
Dyak\GE24880-PA | 181 | GE24880-PA | 1..179 | 1..185 | 464 | 79.1 | Plus |
Dyak\GE25838-PA | 151 | GE25838-PA | 1..123 | 1..123 | 426 | 73.6 | Plus |
Dyak\GE16433-PA | 154 | GE16433-PA | 1..135 | 1..127 | 410 | 69.6 | Plus |