Clone RH14395 Report

Search the DGRC for RH14395

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:143
Well:95
Vector:pFlc-1
Associated Gene/TranscriptCG15529-RA
Protein status:RH14395.pep: gold
Preliminary Size:591
Sequenced Size:980

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15529 2002-01-01 Sim4 clustering to Release 2
CG15529 2002-02-26 Blastp of sequenced clone
CG15529 2003-01-01 Sim4 clustering to Release 3
CG15529 2008-04-29 Release 5.5 accounting
CG15529 2008-08-15 Release 5.9 accounting
CG15529 2008-12-18 5.12 accounting

Clone Sequence Records

RH14395.complete Sequence

980 bp (980 high quality bases) assembled on 2002-02-26

GenBank Submission: AY089656

> RH14395.complete
GAGTCTTCAGCGCAGCTCGATAGCGAAAGATGTTTGCCGGGAGCGGCGGT
CTCAGTGCCACCGATCCATCTAATCCAAGGTCGCGGGAATAGGACTGCTC
TACTGTGTCGTTTGGCGCCATGTGCTGCTGGTGTGCACGTGTCTACTGGA
CGGTTCTGCACAATCTCCTGGCTCGCATGATGGACAGCCTGATGGAAGTC
AGATCGCCCACCTTCTGTAGCTGCTGCTTCGGTTATCAGCGGCAGGCCAG
TCAGGAAGGTGACGTCGCAGAACGGGTTTCCAGCACCGACGACGATCCAC
AACAGCAGCCCCGTGAGGATTACGTCATTGTGGACGATGCCGATGTCAAC
TACGCGGAGATTGAGGAGAGGCATGTGGAAAAGGAGCAGTACTACTTCAC
AGTGGATCGTCCTACGGCGGAGCGAATGCTCCATGGACGAGAGGACGGGT
CCTGCCTGGTTCGACCTTTCAAGGCAGCCGACCAGTGGATCCGTTACATA
GTGAGCATCTGGGCGGCGGATCAGTACTATCACCTGTTCATAAGGCAAGT
GGATAGGAGACAACGCTATGCCATTGGTCAGAAGAAGTCTCAGGAGCGCT
GCTTCGGATCCCCCTCGGAAATCGTGGAGTTCTACACGGAGCATCCACTT
CTCTGCACCAACAAGGTCCGGAGCCAGTGCGTCCAACTCCGTCCCATCAG
TTACGCTTAGCTAGGGGTCAAATCTTTATTGCATAAGAGAGGGCAAGTAT
GTACAAATGGGGTTAGCTTAAGACGATGCTCAGGTGGCCACCACCGCCTT
GAAGGCGCACTGGTTGTTCTGCATCAGGGCGGGCCAGAGGAAGGCTTTTA
TCAGATCCGATCGCCGGTCCGCCTGGGGATGCCGCTCGTGTTTCTCGGGC
CTCAGGAAACCTGCATGGGATTTACGTAGGTGTAAGATTGTTAAACGATT
AAAGAGTAGCTTAAAAAAAAAAAAAAAAAA

RH14395.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:56:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG15529-RA 1194 CG15529-RA 210..1174 2..966 4825 100 Plus
CG15529.a 1407 CG15529.a 443..1407 2..966 4825 100 Plus
CG11498-RA 1903 CG11498-RA 1772..1903 911..780 660 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:50:59
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 25975078..25975707 333..962 3150 100 Plus
chr3R 27901430 chr3R 25974499..25974830 2..333 1660 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:22:46 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:50:57
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 30152642..30153275 333..966 3170 100 Plus
3R 32079331 3R 30152063..30152394 2..333 1660 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:15:22
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 29893473..29894106 333..966 3170 100 Plus
3R 31820162 3R 29892894..29893225 2..333 1660 100 Plus
Blast to na_te.dros performed 2019-03-16 19:50:57
Subject Length Description Subject Range Query Range Score Percent Strand
1731 4648 1731 DMTN1731 4648bp Derived from X07656 (g8700) (Rel. 36, Last updated, Version 6). 2562..2606 252..296 126 75.6 Plus

RH14395.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:51:39 Download gff for RH14395.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 25974498..25974830 1..333 99 -> Plus
chr3R 25975079..25975707 334..962 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:41:55 Download gff for RH14395.complete
Subject Subject Range Query Range Percent Splice Strand
CG15529-RA 1..591 120..710 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:54:19 Download gff for RH14395.complete
Subject Subject Range Query Range Percent Splice Strand
CG15529-RA 1..591 120..710 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:34:57 Download gff for RH14395.complete
Subject Subject Range Query Range Percent Splice Strand
CG15529-RA 1..591 120..710 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:36:50 Download gff for RH14395.complete
Subject Subject Range Query Range Percent Splice Strand
CG15529-RA 1..591 120..710 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:43:53 Download gff for RH14395.complete
Subject Subject Range Query Range Percent Splice Strand
CG15529-RA 1..591 120..710 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:07:06 Download gff for RH14395.complete
Subject Subject Range Query Range Percent Splice Strand
CG15529-RA 2..962 2..962 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:54:19 Download gff for RH14395.complete
Subject Subject Range Query Range Percent Splice Strand
CG15529-RA 2..962 2..962 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:34:57 Download gff for RH14395.complete
Subject Subject Range Query Range Percent Splice Strand
CG15529-RA 4..965 1..962 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:36:50 Download gff for RH14395.complete
Subject Subject Range Query Range Percent Splice Strand
CG15529-RA 2..962 2..962 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:43:53 Download gff for RH14395.complete
Subject Subject Range Query Range Percent Splice Strand
CG15529-RA 4..965 1..962 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:51:39 Download gff for RH14395.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30152062..30152394 1..333 99 -> Plus
3R 30152643..30153271 334..962 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:51:39 Download gff for RH14395.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30152062..30152394 1..333 99 -> Plus
3R 30152643..30153271 334..962 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:51:39 Download gff for RH14395.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30152062..30152394 1..333 99 -> Plus
3R 30152643..30153271 334..962 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:34:57 Download gff for RH14395.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25977784..25978116 1..333 99 -> Plus
arm_3R 25978365..25978993 334..962 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:19:33 Download gff for RH14395.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29892893..29893225 1..333 99 -> Plus
3R 29893474..29894102 334..962 100   Plus

RH14395.pep Sequence

Translation from 119 to 709

> RH14395.pep
MCCWCARVYWTVLHNLLARMMDSLMEVRSPTFCSCCFGYQRQASQEGDVA
ERVSSTDDDPQQQPREDYVIVDDADVNYAEIEERHVEKEQYYFTVDRPTA
ERMLHGREDGSCLVRPFKAADQWIRYIVSIWAADQYYHLFIRQVDRRQRY
AIGQKKSQERCFGSPSEIVEFYTEHPLLCTNKVRSQCVQLRPISYA*

RH14395.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:06:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18824-PA 207 GF18824-PA 1..207 1..196 807 73.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:06:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11734-PA 196 GG11734-PA 1..196 1..196 986 94.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:06:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19179-PA 215 GH19179-PA 2..215 3..196 554 57.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:40:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG15529-PB 196 CG15529-PB 1..196 1..196 1068 100 Plus
CG15529-PA 196 CG15529-PA 1..196 1..196 1068 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:06:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24215-PA 209 GI24215-PA 2..209 3..196 634 61.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:06:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13445-PA 197 GL13445-PA 1..197 1..196 702 67 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:06:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13786-PA 199 GA13786-PA 1..199 1..196 698 66.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:06:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12865-PA 196 GM12865-PA 1..196 1..196 1043 99.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:06:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21505-PA 196 GD21505-PA 1..196 1..196 1043 99.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:06:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10786-PA 210 GJ10786-PA 2..210 3..196 576 61.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:06:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14117-PA 153 GK14117-PA 17..153 61..196 498 69.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:06:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10860-PA 196 GE10860-PA 1..196 1..196 976 93.4 Plus

RH14395.hyp Sequence

Translation from 119 to 709

> RH14395.hyp
MCCWCARVYWTVLHNLLARMMDSLMEVRSPTFCSCCFGYQRQASQEGDVA
ERVSSTDDDPQQQPREDYVIVDDADVNYAEIEERHVEKEQYYFTVDRPTA
ERMLHGREDGSCLVRPFKAADQWIRYIVSIWAADQYYHLFIRQVDRRQRY
AIGQKKSQERCFGSPSEIVEFYTEHPLLCTNKVRSQCVQLRPISYA*

RH14395.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:25:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG15529-PB 196 CG15529-PB 1..196 1..196 1068 100 Plus
CG15529-PA 196 CG15529-PA 1..196 1..196 1068 100 Plus