Clone RH14578 Report

Search the DGRC for RH14578

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:145
Well:78
Vector:pFlc-1
Associated Gene/TranscriptVps25-RA
Protein status:RH14578.pep: gold
Preliminary Size:525
Sequenced Size:692

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14750 2002-01-01 Sim4 clustering to Release 2
CG14750 2002-02-26 Blastp of sequenced clone
CG14750 2003-01-01 Sim4 clustering to Release 3
Vps25 2008-04-29 Release 5.5 accounting
Vps25 2008-08-15 Release 5.9 accounting
Vps25 2008-12-18 5.12 accounting

Clone Sequence Records

RH14578.complete Sequence

692 bp (692 high quality bases) assembled on 2002-02-26

GenBank Submission: AY089657

> RH14578.complete
GGCATATGGTCACTCTAGGCCATTAGTAATAACTTACATTGGAAAAACAA
ATGTTTAGATCGTAGTTAATCAGCATGGCGGAGTTCCAGTGGCCCTGGGA
GTACACCTTCCCACCCTTCTTTACACTACAGCCCCACGAAGAAACCAGAC
AGCAGCAGCTGAAGGTCTGGACAGATCTCTTTCTCAAATACCTCAGGCAC
ACGAATAGGTTTACTCTCAGCATTGGGGACCAGAACTCGCCGCTGTTCCA
CAACGAAGCGCTGAAGCGCCGCCTCTCGCCGGAACTCGTCCTGGCCATTC
TGGGCGAGCTGGAGCGGAGCGGGCATGCGAATCCGCTGGACAAGCGACGC
CAGGAGTGGCAGGTGTACTGGTTCACCCTCGAGGAGTACGGCAACATGGT
GTACGACTGGGTGCAGGAAACGGGCCAGACGAACACCATCTGCACGCTGT
ACGAAATAGCCTCCGGCGAGAACACCTCTCACCTGGACTTTTACGGCGTG
GACGAGGCGGTGCTGCTCAGTGCCCTCCGGTTGCTGGAGGAAAAGGGCAG
GTGTGAGCTGATCGAGATGGACGGCAGCCACGGCGTTAAGTTCTTCTAAG
TGTCCATTCTAATTGTTTACCTTGTCTTGTGGCGCATCCCGAATTATGTC
ATAATGGAGTAAAGTATTGTAAAATGTAAAAAAAAAAAAAAA

RH14578.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:48:28
Subject Length Description Subject Range Query Range Score Percent Strand
Vps25-RA 786 Vps25-RA 3..679 2..678 3385 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:27:35
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 4513227..4513779 125..677 2750 99.8 Plus
chr2R 21145070 chr2R 4513052..4513174 2..124 615 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:22:51 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:27:34
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8625628..8626181 125..678 2770 100 Plus
2R 25286936 2R 8625453..8625575 2..124 615 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:08:20
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 8626827..8627380 125..678 2770 100 Plus
2R 25260384 2R 8626652..8626774 2..124 615 100 Plus
Blast to na_te.dros performed on 2019-03-16 15:27:34 has no hits.

RH14578.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:28:35 Download gff for RH14578.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 4513050..4513174 1..124 99 -> Plus
chr2R 4513227..4513779 125..677 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:42:04 Download gff for RH14578.complete
Subject Subject Range Query Range Percent Splice Strand
Vps25-RA 1..525 75..599 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:43:07 Download gff for RH14578.complete
Subject Subject Range Query Range Percent Splice Strand
Vps25-RA 1..525 75..599 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:11:05 Download gff for RH14578.complete
Subject Subject Range Query Range Percent Splice Strand
Vps25-RA 1..525 75..599 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:22:10 Download gff for RH14578.complete
Subject Subject Range Query Range Percent Splice Strand
Vps25-RA 1..525 75..599 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:42:22 Download gff for RH14578.complete
Subject Subject Range Query Range Percent Splice Strand
Vps25-RA 1..525 75..599 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:50:31 Download gff for RH14578.complete
Subject Subject Range Query Range Percent Splice Strand
Vps25-RA 1..678 1..677 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:43:07 Download gff for RH14578.complete
Subject Subject Range Query Range Percent Splice Strand
Vps25-RA 1..678 1..677 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:11:05 Download gff for RH14578.complete
Subject Subject Range Query Range Percent Splice Strand
Vps25-RA 1..678 1..677 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:22:11 Download gff for RH14578.complete
Subject Subject Range Query Range Percent Splice Strand
Vps25-RA 1..678 1..677 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:42:22 Download gff for RH14578.complete
Subject Subject Range Query Range Percent Splice Strand
Vps25-RA 1..678 1..677 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:28:35 Download gff for RH14578.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8625451..8625575 1..124 99 -> Plus
2R 8625628..8626180 125..677 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:28:35 Download gff for RH14578.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8625451..8625575 1..124 99 -> Plus
2R 8625628..8626180 125..677 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:28:35 Download gff for RH14578.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8625451..8625575 1..124 99 -> Plus
2R 8625628..8626180 125..677 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:11:05 Download gff for RH14578.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4512956..4513080 1..124 99 -> Plus
arm_2R 4513133..4513685 125..677 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:56:46 Download gff for RH14578.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8626827..8627379 125..677 100   Plus
2R 8626650..8626774 1..124 99 -> Plus

RH14578.hyp Sequence

Translation from 74 to 598

> RH14578.hyp
MAEFQWPWEYTFPPFFTLQPHEETRQQQLKVWTDLFLKYLRHTNRFTLSI
GDQNSPLFHNEALKRRLSPELVLAILGELERSGHANPLDKRRQEWQVYWF
TLEEYGNMVYDWVQETGQTNTICTLYEIASGENTSHLDFYGVDEAVLLSA
LRLLEEKGRCELIEMDGSHGVKFF*

RH14578.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:25:56
Subject Length Description Subject Range Query Range Score Percent Strand
Vps25-PA 174 CG14750-PA 1..174 1..174 944 100 Plus

RH14578.pep Sequence

Translation from 74 to 598

> RH14578.pep
MAEFQWPWEYTFPPFFTLQPHEETRQQQLKVWTDLFLKYLRHTNRFTLSI
GDQNSPLFHNEALKRRLSPELVLAILGELERSGHANPLDKRRQEWQVYWF
TLEEYGNMVYDWVQETGQTNTICTLYEIASGENTSHLDFYGVDEAVLLSA
LRLLEEKGRCELIEMDGSHGVKFF*

RH14578.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:24:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12370-PA 174 GF12370-PA 1..174 1..174 869 88.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:24:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23371-PA 174 GG23371-PA 1..174 1..174 838 88.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:24:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20084-PA 174 GH20084-PA 1..174 1..174 777 79.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:07:15
Subject Length Description Subject Range Query Range Score Percent Strand
Vps25-PA 174 CG14750-PA 1..174 1..174 944 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:24:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18799-PA 174 GI18799-PA 1..174 1..174 739 80.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:24:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10906-PA 174 GL10906-PA 1..174 1..174 814 82.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:24:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13223-PA 174 GA13223-PA 1..174 1..174 814 82.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:24:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21050-PA 186 GM21050-PA 1..172 1..172 902 97.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:24:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10582-PA 174 GD10582-PA 1..174 1..174 918 98.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:24:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21827-PA 174 GJ21827-PA 1..174 1..174 738 81 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:24:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21729-PA 174 GK21729-PA 1..174 1..174 773 84.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:24:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19214-PA 174 GE19214-PA 1..174 1..174 905 96 Plus