BDGP Sequence Production Resources |
Search the DGRC for RH14578
Library: | RH |
Tissue Source: | Drosophila melanogaster adult head |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2001-04-30 |
Comments: | Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 145 |
Well: | 78 |
Vector: | pFlc-1 |
Associated Gene/Transcript | Vps25-RA |
Protein status: | RH14578.pep: gold |
Preliminary Size: | 525 |
Sequenced Size: | 692 |
Gene | Date | Evidence |
---|---|---|
CG14750 | 2002-01-01 | Sim4 clustering to Release 2 |
CG14750 | 2002-02-26 | Blastp of sequenced clone |
CG14750 | 2003-01-01 | Sim4 clustering to Release 3 |
Vps25 | 2008-04-29 | Release 5.5 accounting |
Vps25 | 2008-08-15 | Release 5.9 accounting |
Vps25 | 2008-12-18 | 5.12 accounting |
692 bp (692 high quality bases) assembled on 2002-02-26
GenBank Submission: AY089657
> RH14578.complete GGCATATGGTCACTCTAGGCCATTAGTAATAACTTACATTGGAAAAACAA ATGTTTAGATCGTAGTTAATCAGCATGGCGGAGTTCCAGTGGCCCTGGGA GTACACCTTCCCACCCTTCTTTACACTACAGCCCCACGAAGAAACCAGAC AGCAGCAGCTGAAGGTCTGGACAGATCTCTTTCTCAAATACCTCAGGCAC ACGAATAGGTTTACTCTCAGCATTGGGGACCAGAACTCGCCGCTGTTCCA CAACGAAGCGCTGAAGCGCCGCCTCTCGCCGGAACTCGTCCTGGCCATTC TGGGCGAGCTGGAGCGGAGCGGGCATGCGAATCCGCTGGACAAGCGACGC CAGGAGTGGCAGGTGTACTGGTTCACCCTCGAGGAGTACGGCAACATGGT GTACGACTGGGTGCAGGAAACGGGCCAGACGAACACCATCTGCACGCTGT ACGAAATAGCCTCCGGCGAGAACACCTCTCACCTGGACTTTTACGGCGTG GACGAGGCGGTGCTGCTCAGTGCCCTCCGGTTGCTGGAGGAAAAGGGCAG GTGTGAGCTGATCGAGATGGACGGCAGCCACGGCGTTAAGTTCTTCTAAG TGTCCATTCTAATTGTTTACCTTGTCTTGTGGCGCATCCCGAATTATGTC ATAATGGAGTAAAGTATTGTAAAATGTAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Vps25-RA | 786 | Vps25-RA | 3..679 | 2..678 | 3385 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 4513050..4513174 | 1..124 | 99 | -> | Plus |
chr2R | 4513227..4513779 | 125..677 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Vps25-RA | 1..525 | 75..599 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Vps25-RA | 1..525 | 75..599 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Vps25-RA | 1..525 | 75..599 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Vps25-RA | 1..525 | 75..599 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Vps25-RA | 1..525 | 75..599 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Vps25-RA | 1..678 | 1..677 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Vps25-RA | 1..678 | 1..677 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Vps25-RA | 1..678 | 1..677 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Vps25-RA | 1..678 | 1..677 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Vps25-RA | 1..678 | 1..677 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 8625451..8625575 | 1..124 | 99 | -> | Plus |
2R | 8625628..8626180 | 125..677 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 8625451..8625575 | 1..124 | 99 | -> | Plus |
2R | 8625628..8626180 | 125..677 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 8625451..8625575 | 1..124 | 99 | -> | Plus |
2R | 8625628..8626180 | 125..677 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 4512956..4513080 | 1..124 | 99 | -> | Plus |
arm_2R | 4513133..4513685 | 125..677 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 8626827..8627379 | 125..677 | 100 | Plus | |
2R | 8626650..8626774 | 1..124 | 99 | -> | Plus |
Translation from 74 to 598
> RH14578.hyp MAEFQWPWEYTFPPFFTLQPHEETRQQQLKVWTDLFLKYLRHTNRFTLSI GDQNSPLFHNEALKRRLSPELVLAILGELERSGHANPLDKRRQEWQVYWF TLEEYGNMVYDWVQETGQTNTICTLYEIASGENTSHLDFYGVDEAVLLSA LRLLEEKGRCELIEMDGSHGVKFF*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Vps25-PA | 174 | CG14750-PA | 1..174 | 1..174 | 944 | 100 | Plus |
Translation from 74 to 598
> RH14578.pep MAEFQWPWEYTFPPFFTLQPHEETRQQQLKVWTDLFLKYLRHTNRFTLSI GDQNSPLFHNEALKRRLSPELVLAILGELERSGHANPLDKRRQEWQVYWF TLEEYGNMVYDWVQETGQTNTICTLYEIASGENTSHLDFYGVDEAVLLSA LRLLEEKGRCELIEMDGSHGVKFF*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF12370-PA | 174 | GF12370-PA | 1..174 | 1..174 | 869 | 88.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG23371-PA | 174 | GG23371-PA | 1..174 | 1..174 | 838 | 88.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH20084-PA | 174 | GH20084-PA | 1..174 | 1..174 | 777 | 79.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Vps25-PA | 174 | CG14750-PA | 1..174 | 1..174 | 944 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI18799-PA | 174 | GI18799-PA | 1..174 | 1..174 | 739 | 80.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL10906-PA | 174 | GL10906-PA | 1..174 | 1..174 | 814 | 82.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA13223-PA | 174 | GA13223-PA | 1..174 | 1..174 | 814 | 82.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM21050-PA | 186 | GM21050-PA | 1..172 | 1..172 | 902 | 97.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD10582-PA | 174 | GD10582-PA | 1..174 | 1..174 | 918 | 98.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ21827-PA | 174 | GJ21827-PA | 1..174 | 1..174 | 738 | 81 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK21729-PA | 174 | GK21729-PA | 1..174 | 1..174 | 773 | 84.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE19214-PA | 174 | GE19214-PA | 1..174 | 1..174 | 905 | 96 | Plus |