Clone RH14616 Report

Search the DGRC for RH14616

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:146
Well:16
Vector:pFlc-1
Associated Gene/TranscriptCG7059-RD
Protein status:RH14616.pep: gold
Sequenced Size:1242

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7059-RD 2009-06-22 Replacement based on scoring

Clone Sequence Records

RH14616.complete Sequence

1242 bp assembled on 2009-08-13

GenBank Submission: BT099570.1

> RH14616.complete
GAGTGCGGATTGGCATCCGAAAGATACAGGAACGTGGTGGCTGCAGCTGC
AACGGGAAGACCATGGTTTTCTTCAAGTTCTTGAAGAGCAAACTGTAACG
TATATAAAGGCAACCACAACACAAAGTAAACACACGCGAAAATCCTAACG
AAATAGAGAGATACAACAAAAAGATACGAAAAAAGATACAACCCACGAGA
ATAACAATGCGCGAAATTCAGGCCTCCCAATTTATGACGAAAACAAATCG
CTTGGTGATTTTGAGGCATGGCGAAAGTGATTTCAACATTGAGAACAAAT
TCTGCGGTTGGCATGATGCGCCATTGAGTGAATTCGGCGTCCAGGAGGCC
CTGACTGTGGCGATTCCCGCGCTCGTCCAATCCGAGTTGGAATTCGACGT
GGTCTATTCATCCGTATTGAGCAGATCTCGTCAAACGGCCGAATTGATAC
TCTCCAAGTTGAACTGCGCCTATGTGCCCATTAAGGAGGATTGGCGGCTG
TGCGAAAGGCACTACGGAAATCTGACTGGTTGCCGGAAACGAGTGGTAGC
CGATCGCTATGGGGAGGAGCAGGTTCAGGCCTGGCGACGTGGATACGACT
GCGTACCGCCGCCCATCGATGAGAAGAACCGCTACTTCTACACCATTTGC
AGCAATCCCATATTCGATGATGTTCCTCGCGGTGAGTTCCCCCTCGCGGA
ATCCCTTCACATGTGCGTCGATCGAGTGAAACCCGTGTGGAAGGAGGTCA
GGCGGGAAGTGTTCCAAGGCACCCGGGTACTAATGTGCGTCCACGGAACT
GTGGCCCGTGCTCTCGTCCAGCACATTGAGGGAATCTCCAACGAGGCCAT
CGAAAAGGTTAACATTCCAAATTGCGTGCCACGCGTCTATGAGTTCGATT
TGAAAACGGGAGGCTTGGTTGGAGCTGCCATCAATCTGGGGGATCAGGAG
TATATTAGGCGGAAGACAGCCCAGGTGGCAGCCATTGGTGACTGATTGTG
GAGCACTCCTCTCGACTTTTTTGGAATTTACATCGATATGTGGCCGACTG
CATTTACTTAAGCCTTTGCCGCTTAAAGTCCGAGAACATCGGCTGATAAG
GATATTATGACTACTATTTATTGGTCTACACCATCTGATATTTTCGGCCA
AAAATATACAATTTATACAAAATATAATTGATGGAGAAGATTACATATAC
GTACATAAATATAATAAAAATAAGCTAAAAAAAAAAAAAAAA

RH14616.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:30:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG7059.d 1582 CG7059.d 310..1535 2..1227 6130 100 Plus
CG7059-RD 1274 CG7059-RD 2..1227 2..1227 6130 100 Plus
CG7059.e 1653 CG7059.e 381..1606 2..1227 6130 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:49:41
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 18214900..18215396 336..832 2455 99.6 Plus
chr3R 27901430 chr3R 18215451..18215846 831..1226 1980 100 Plus
chr3R 27901430 chr3R 18213523..18213744 2..223 1095 99.5 Plus
chr3R 27901430 chr3R 18214725..18214838 224..337 570 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:22:52 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:49:39
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 22391368..22391864 336..832 2485 100 Plus
3R 32079331 3R 22391919..22392315 831..1227 1985 100 Plus
3R 32079331 3R 22389981..22390202 2..223 1110 100 Plus
3R 32079331 3R 22391194..22391307 224..337 570 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:26:19
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 22132199..22132695 336..832 2485 100 Plus
3R 31820162 3R 22132750..22133146 831..1227 1985 100 Plus
3R 31820162 3R 22130812..22131033 2..223 1110 100 Plus
3R 31820162 3R 22132025..22132138 224..337 570 100 Plus
Blast to na_te.dros performed 2019-03-16 21:49:40
Subject Length Description Subject Range Query Range Score Percent Strand
HMS-Beagle 7062 HMS-Beagle Beagle 7062bp 1097..1171 1223..1150 111 66.2 Minus

RH14616.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:50:39 Download gff for RH14616.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 18213522..18213744 1..223 99 -> Plus
chr3R 18214725..18214837 224..336 100 -> Plus
chr3R 18214901..18215395 337..831 99 -> Plus
chr3R 18215452..18215846 832..1226 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:13:58 Download gff for RH14616.complete
Subject Subject Range Query Range Percent Splice Strand
CG7059-RD 1..789 207..995 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:58:23 Download gff for RH14616.complete
Subject Subject Range Query Range Percent Splice Strand
CG7059-RD 1..789 207..995 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:03:52 Download gff for RH14616.complete
Subject Subject Range Query Range Percent Splice Strand
CG7059-RD 1..789 207..995 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:32:54 Download gff for RH14616.complete
Subject Subject Range Query Range Percent Splice Strand
CG7059-RD 1..789 207..995 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-08-13 10:02:36 Download gff for RH14616.complete
Subject Subject Range Query Range Percent Splice Strand
CG7059-RD 2..1226 2..1226 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:58:23 Download gff for RH14616.complete
Subject Subject Range Query Range Percent Splice Strand
CG7059-RD 2..1226 2..1226 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:03:52 Download gff for RH14616.complete
Subject Subject Range Query Range Percent Splice Strand
CG7059-RD 2..1226 2..1226 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:32:54 Download gff for RH14616.complete
Subject Subject Range Query Range Percent Splice Strand
CG7059-RD 2..1226 2..1226 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:50:39 Download gff for RH14616.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22389980..22390202 1..223 99 -> Plus
3R 22391194..22391306 224..336 100 -> Plus
3R 22391369..22391863 337..831 100 -> Plus
3R 22391920..22392314 832..1226 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:50:39 Download gff for RH14616.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22389980..22390202 1..223 99 -> Plus
3R 22391194..22391306 224..336 100 -> Plus
3R 22391369..22391863 337..831 100 -> Plus
3R 22391920..22392314 832..1226 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:50:39 Download gff for RH14616.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22389980..22390202 1..223 99 -> Plus
3R 22391194..22391306 224..336 100 -> Plus
3R 22391369..22391863 337..831 100 -> Plus
3R 22391920..22392314 832..1226 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:03:52 Download gff for RH14616.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 18215702..18215924 1..223 99 -> Plus
arm_3R 18216916..18217028 224..336 100 -> Plus
arm_3R 18217091..18217585 337..831 100 -> Plus
arm_3R 18217642..18218036 832..1226 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:50:01 Download gff for RH14616.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22130811..22131033 1..223 99 -> Plus
3R 22132025..22132137 224..336 100 -> Plus
3R 22132200..22132694 337..831 100 -> Plus
3R 22132751..22133145 832..1226 100   Plus

RH14616.pep Sequence

Translation from 206 to 994

> RH14616.pep
MREIQASQFMTKTNRLVILRHGESDFNIENKFCGWHDAPLSEFGVQEALT
VAIPALVQSELEFDVVYSSVLSRSRQTAELILSKLNCAYVPIKEDWRLCE
RHYGNLTGCRKRVVADRYGEEQVQAWRRGYDCVPPPIDEKNRYFYTICSN
PIFDDVPRGEFPLAESLHMCVDRVKPVWKEVRREVFQGTRVLMCVHGTVA
RALVQHIEGISNEAIEKVNIPNCVPRVYEFDLKTGGLVGAAINLGDQEYI
RRKTAQVAAIGD*

RH14616.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 16:53:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18444-PA 265 GF18444-PA 8..264 5..261 1069 73.2 Plus
Dana\GF23292-PA 255 GF23292-PA 1..252 10..261 500 41.7 Plus
Dana\GF17736-PA 288 GF17736-PA 39..285 15..261 497 38.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 16:54:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11129-PA 267 GG11129-PA 10..267 5..262 1338 95.7 Plus
Dere\GG17149-PA 292 GG17149-PA 43..289 15..261 505 41.4 Plus
Dere\GG11648-PA 255 GG11648-PA 1..252 10..261 500 41.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 16:54:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13344-PA 265 GH13344-PA 8..265 5..262 904 61.6 Plus
Dgri\GH15422-PA 247 GH15422-PA 1..244 18..261 505 39 Plus
Dgri\GH23221-PA 255 GH23221-PA 1..252 10..261 493 40.9 Plus
Dgri\GH14297-PA 255 GH14297-PA 1..252 10..261 493 40.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:48:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG7059-PD 262 CG7059-PD 1..262 1..262 1388 100 Plus
CG7059-PA 267 CG7059-PA 12..267 7..262 1360 100 Plus
CG7059-PC 253 CG7059-PC 1..253 10..262 1345 100 Plus
Pglym78-PC 255 CG1721-PC 6..252 15..261 501 41.4 Plus
Pglym78-PB 255 CG1721-PB 6..252 15..261 501 41.4 Plus
Pglym78-PA 255 CG1721-PA 6..252 15..261 501 41.4 Plus
Pglym87-PA 292 CG17645-PA 43..289 15..261 486 41 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 16:54:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22381-PA 268 GI22381-PA 1..268 1..262 882 59.7 Plus
Dmoj\GI10280-PA 293 GI10280-PA 45..290 16..261 521 39.1 Plus
Dmoj\GI23192-PA 255 GI23192-PA 1..252 10..261 499 41.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 16:54:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24208-PA 267 GL24208-PA 10..267 5..262 1058 73.3 Plus
Dper\GL23914-PA 255 GL23914-PA 1..252 10..261 526 41.3 Plus
Dper\GL21564-PA 309 GL21564-PA 60..306 15..261 526 41.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 16:54:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20068-PA 267 GA20068-PA 10..267 5..262 1058 73.3 Plus
Dpse\GA20068-PB 252 GA20068-PB 2..252 12..262 1039 74.1 Plus
Dpse\GA14593-PA 290 GA14593-PA 41..287 15..261 533 42.6 Plus
Dpse\GA14392-PA 255 GA14392-PA 1..252 10..261 526 41.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 16:54:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26427-PA 267 GM26427-PA 10..267 5..262 1368 98.1 Plus
Dsec\GM26030-PA 292 GM26030-PA 43..289 15..261 503 41.4 Plus
Dsec\GM12771-PA 255 GM12771-PA 1..252 10..261 498 41.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 16:54:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20944-PA 267 GD20944-PA 10..267 5..262 1369 98.1 Plus
Dsim\GD20588-PA 341 GD20588-PA 43..286 15..258 498 41.5 Plus
Dsim\GD21420-PA 429 GD21420-PA 6..112 15..122 279 50 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 16:54:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24414-PA 265 GJ24414-PA 8..265 5..262 886 60.9 Plus
Dvir\GJ11087-PA 299 GJ11087-PA 51..296 16..261 506 40.7 Plus
Dvir\GJ14508-PA 255 GJ14508-PA 1..252 10..261 498 41.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 16:54:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14265-PA 267 GK14265-PA 10..266 5..261 1002 66.9 Plus
Dwil\GK11893-PA 255 GK11893-PA 1..252 10..261 529 41.7 Plus
Dwil\GK11561-PA 287 GK11561-PA 37..284 15..261 500 40.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 16:54:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10295-PA 253 GE10295-PA 1..253 10..262 1307 95.7 Plus
Dyak\GE24538-PA 292 GE24538-PA 43..289 15..261 501 41.4 Plus
Dyak\Pglym78-PA 255 GE23839-PA 1..252 10..261 492 41.3 Plus

RH14616.hyp Sequence

Translation from 206 to 994

> RH14616.hyp
MREIQASQFMTKTNRLVILRHGESDFNIENKFCGWHDAPLSEFGVQEALT
VAIPALVQSELEFDVVYSSVLSRSRQTAELILSKLNCAYVPIKEDWRLCE
RHYGNLTGCRKRVVADRYGEEQVQAWRRGYDCVPPPIDEKNRYFYTICSN
PIFDDVPRGEFPLAESLHMCVDRVKPVWKEVRREVFQGTRVLMCVHGTVA
RALVQHIEGISNEAIEKVNIPNCVPRVYEFDLKTGGLVGAAINLGDQEYI
RRKTAQVAAIGD*

RH14616.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:58:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG7059-PD 262 CG7059-PD 1..262 1..262 1388 100 Plus
CG7059-PA 267 CG7059-PA 12..267 7..262 1360 100 Plus
CG7059-PC 253 CG7059-PC 1..253 10..262 1345 100 Plus
Pglym78-PC 255 CG1721-PC 6..252 15..261 501 41.4 Plus
Pglym78-PB 255 CG1721-PB 6..252 15..261 501 41.4 Plus