Clone RH14671 Report

Search the DGRC for RH14671

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:146
Well:71
Vector:pFlc-1
Associated Gene/TranscriptCG33178-RA
Protein status:RH14671.pep: gold
Preliminary Size:747
Sequenced Size:600

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG33178 2001-12-17 Blastp of sequenced clone
CG5579 2002-01-01 Sim4 clustering to Release 2
CG33178 2003-01-01 Sim4 clustering to Release 3
CG33178 2008-04-29 Release 5.5 accounting
CG33178 2008-08-15 Release 5.9 accounting
CG33178 2008-12-18 5.12 accounting

Clone Sequence Records

RH14671.complete Sequence

600 bp (600 high quality bases) assembled on 2001-12-17

GenBank Submission: AY071694

> RH14671.complete
GATTTGTCGAAGTCGGCTCAAAGCGAACGCACACACATTCCGCATCCGCC
ATGTCGGCCGCAGCTAGTAATTCCAGCAAGATGATGACATCGCCCGGCGA
TATGTTTACCCTGGAGAATCCTGTCTTTTGCTGCTATCTTTTTTGGTCCA
CAGTCCTGGTGGTGAAGATGCTGCTCATGTCGCTGCTAACGGCCGTTCAG
CGTTTCCGGTATAAGATCTTTCCCAACCAGGAGGATCTGTTCTTCAAGAA
TCTTGAAGTGCAATTCGATGATCCGCATGTGGAGCGGGTCAGAAGGGCCC
ATCGCAATGACATGGAGAACATTCTGCCGTATTTTATCATGTCCTTGATT
TATATCAGTACCAATCCGAATGCCGATGTGGCCTGCATACTGTTCCGAGT
GGCCTCCGTGGCCAGGATCATACACACTCTGGTTTACGCCGTTTATCCGG
TGCCGCAGCCATCGAGGATTCTAGCCTTCGCCACCATGCTACTGATCACC
TTCTACATGGCCGCCGTGGTCGCCCTGCGTACCCTAAGCTTTATATGAAT
AAATTCAAGTCCCTTTCGGCTTAACCCTCAAAAGAAAAAAAAAAAAAAAA

RH14671.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:35:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG33178-RA 933 CG33178-RA 223..803 2..582 2905 100 Plus
CG33178.a 946 CG33178.a 463..830 215..582 1840 100 Plus
CG33178.a 946 CG33178.a 214..427 2..215 1070 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 23:44:03
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 14973652..14973940 294..582 1445 100 Plus
chrX 22417052 chrX 14972994..14973207 2..215 1070 100 Plus
chrX 22417052 chrX 14973421..14973503 214..296 415 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:22:54 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 23:44:01
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 15083486..15083774 294..582 1445 100 Plus
X 23542271 X 15082828..15083041 2..215 1070 100 Plus
X 23542271 X 15083255..15083337 214..296 415 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:02:55
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 15091584..15091872 294..582 1445 100 Plus
X 23527363 X 15090926..15091139 2..215 1070 100 Plus
X 23527363 X 15091353..15091435 214..296 415 100 Plus
Blast to na_te.dros performed on 2019-03-16 23:44:01 has no hits.

RH14671.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 23:44:41 Download gff for RH14671.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 14972993..14973207 1..215 99 -> Plus
chrX 14973423..14973502 216..295 100 -> Plus
chrX 14973654..14973940 296..584 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:42:06 Download gff for RH14671.complete
Subject Subject Range Query Range Percent Splice Strand
CG33178-RA 1..498 51..548 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:57:40 Download gff for RH14671.complete
Subject Subject Range Query Range Percent Splice Strand
CG33178-RA 1..498 51..548 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:23:40 Download gff for RH14671.complete
Subject Subject Range Query Range Percent Splice Strand
CG33178-RA 1..498 51..548 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:22:39 Download gff for RH14671.complete
Subject Subject Range Query Range Percent Splice Strand
CG33178-RA 1..498 51..548 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:57:26 Download gff for RH14671.complete
Subject Subject Range Query Range Percent Splice Strand
CG33178-RA 1..498 51..548 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:22:41 Download gff for RH14671.complete
Subject Subject Range Query Range Percent Splice Strand
CG33178-RA 2..582 2..584 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:57:40 Download gff for RH14671.complete
Subject Subject Range Query Range Percent Splice Strand
CG33178-RA 2..582 2..584 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:23:40 Download gff for RH14671.complete
Subject Subject Range Query Range Percent Splice Strand
CG33178-RA 2..582 2..584 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:22:39 Download gff for RH14671.complete
Subject Subject Range Query Range Percent Splice Strand
CG33178-RA 2..582 2..584 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:57:26 Download gff for RH14671.complete
Subject Subject Range Query Range Percent Splice Strand
CG33178-RA 2..582 2..584 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:44:41 Download gff for RH14671.complete
Subject Subject Range Query Range Percent Splice Strand
X 15083488..15083774 296..584 99   Plus
X 15082827..15083041 1..215 99 -> Plus
X 15083257..15083336 216..295 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:44:41 Download gff for RH14671.complete
Subject Subject Range Query Range Percent Splice Strand
X 15083488..15083774 296..584 99   Plus
X 15082827..15083041 1..215 99 -> Plus
X 15083257..15083336 216..295 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:44:41 Download gff for RH14671.complete
Subject Subject Range Query Range Percent Splice Strand
X 15083488..15083774 296..584 99   Plus
X 15082827..15083041 1..215 99 -> Plus
X 15083257..15083336 216..295 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:23:40 Download gff for RH14671.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 14976860..14977074 1..215 99 -> Plus
arm_X 14977290..14977369 216..295 100 -> Plus
arm_X 14977521..14977807 296..584 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:57:23 Download gff for RH14671.complete
Subject Subject Range Query Range Percent Splice Strand
X 15090925..15091139 1..215 99 -> Plus
X 15091355..15091434 216..295 100 -> Plus
X 15091586..15091872 296..584 99   Plus

RH14671.hyp Sequence

Translation from 2 to 547

> RH14671.hyp
FVEVGSKRTHTHSASAMSAAASNSSKMMTSPGDMFTLENPVFCCYLFWST
VLVVKMLLMSLLTAVQRFRYKIFPNQEDLFFKNLEVQFDDPHVERVRRAH
RNDMENILPYFIMSLIYISTNPNADVACILFRVASVARIIHTLVYAVYPV
PQPSRILAFATMLLITFYMAAVVALRTLSFI*

RH14671.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:27:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG33178-PC 165 CG33178-PC 1..165 17..181 840 100 Plus
CG33178-PA 165 CG33178-PA 1..165 17..181 840 100 Plus
CG33178-PB 177 CG33178-PB 1..177 17..181 817 93.2 Plus
Mgstl-PA 152 CG1742-PA 1..146 28..173 446 61 Plus
CG33177-PA 167 CG33177-PA 19..167 34..181 405 52.3 Plus

RH14671.pep Sequence

Translation from 50 to 547

> RH14671.pep
MSAAASNSSKMMTSPGDMFTLENPVFCCYLFWSTVLVVKMLLMSLLTAVQ
RFRYKIFPNQEDLFFKNLEVQFDDPHVERVRRAHRNDMENILPYFIMSLI
YISTNPNADVACILFRVASVARIIHTLVYAVYPVPQPSRILAFATMLLIT
FYMAAVVALRTLSFI*

RH14671.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 03:04:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21219-PA 170 GF21219-PA 6..170 1..165 740 83.6 Plus
Dana\GF21709-PA 195 GF21709-PA 44..186 12..154 463 60.8 Plus
Dana\GF21218-PA 170 GF21218-PA 1..170 1..165 424 50.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 03:04:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17862-PA 165 GG17862-PA 1..165 1..165 855 98.2 Plus
Dere\GG19704-PA 195 GG19704-PA 44..186 12..154 459 60.8 Plus
Dere\GG17861-PA 167 GG17861-PA 19..159 18..157 414 53.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 03:04:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24641-PA 162 GH24641-PA 2..162 17..165 661 78.3 Plus
Dgri\GH12207-PA 191 GH12207-PA 45..187 17..159 467 63.6 Plus
Dgri\GH24640-PA 167 GH24640-PA 15..167 14..165 414 51 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:45:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG33178-PC 165 CG33178-PC 1..165 1..165 840 100 Plus
CG33178-PA 165 CG33178-PA 1..165 1..165 840 100 Plus
CG33178-PB 177 CG33178-PB 1..177 1..165 817 93.2 Plus
Mgstl-PA 152 CG1742-PA 1..146 12..157 446 61 Plus
CG33177-PA 167 CG33177-PA 19..167 18..165 405 52.3 Plus
Mgstl-PC 151 CG1742-PC 5..145 17..157 392 54.6 Plus
Mgstl-PB 151 CG1742-PB 5..145 17..157 392 54.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 03:04:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21688-PA 177 GI21688-PA 17..177 17..165 680 80.1 Plus
Dmoj\GI15739-PA 150 GI15739-PA 4..141 17..154 445 60.9 Plus
Dmoj\GI21687-PA 159 GI21687-PA 11..159 18..165 384 47.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 03:04:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15178-PA 163 GL15178-PA 2..163 5..165 734 85.8 Plus
Dper\GL16397-PA 195 GL16397-PA 44..191 12..159 460 60.1 Plus
Dper\GL15177-PA 166 GL15177-PA 10..166 12..165 413 53.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 03:04:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22801-PA 163 GA22801-PA 2..163 5..165 734 85.8 Plus
Dpse\GA14506-PA 195 GA14506-PA 44..191 12..159 460 60.1 Plus
Dpse\GA22800-PA 166 GA22800-PA 10..166 12..165 412 53.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 03:04:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12056-PA 165 GM12056-PA 1..165 1..165 866 100 Plus
Dsec\GM23058-PA 195 GM23058-PA 44..186 12..154 460 61.5 Plus
Dsec\GM12055-PA 167 GM12055-PA 19..167 18..165 414 51.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 03:04:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17192-PA 165 GD17192-PA 1..165 1..165 866 100 Plus
Dsim\GD17510-PA 195 GD17510-PA 44..186 12..154 457 61.5 Plus
Dsim\GD17191-PA 167 GD17191-PA 19..167 18..165 414 51.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 03:04:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15869-PA 162 GJ15869-PA 2..162 17..165 675 79.5 Plus
Dvir\GJ18600-PA 191 GJ18600-PA 51..182 23..154 450 65.2 Plus
Dvir\GJ15868-PA 165 GJ15868-PA 1..165 1..165 425 50.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 03:04:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16260-PA 185 GK16260-PA 2..185 5..165 698 76.1 Plus
Dwil\GK25033-PA 152 GK25033-PA 1..148 12..159 444 58.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 03:04:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17164-PA 165 GE17164-PA 1..165 1..165 863 99.4 Plus
Dyak\GE17903-PA 195 GE17903-PA 44..186 12..154 434 59.4 Plus
Dyak\GE17163-PA 167 GE17163-PA 19..167 18..165 418 52.3 Plus