Clone RH15675 Report

Search the DGRC for RH15675

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:156
Well:75
Vector:pFlc-1
Associated Gene/TranscriptCG16713-RA
Protein status:RH15675.pep: gold
Sequenced Size:337

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG16713-RA 2009-01-21 est gleaning

Clone Sequence Records

RH15675.complete Sequence

337 bp assembled on 2009-03-10

GenBank Submission: BT072875.1

> RH15675.complete
GTCAGTTTGCTCTCATCGCAATCAGCTAAAGGTTTTGAATATCTCTGAAC
TATGAAACTGTTGATTTTGGTTTTCGTGTTTGTCGCTTTTGTGGCCAACG
CCTTGGCCCTGAAAAATGCAATCTGTGGTCTACCCCATTCCCTAAACGGA
GATGGCAGAATATCCTGTGAGGCCTATATACCCAGTTGGTCCTACGACGC
CGATCGAAACGAGTGCGTCAAATTTATCTACGGAGGCTGCGGAGGCAATA
ACAATAGATTTAATTCGAGGGAAATCTGTGAAGACAAGTGTTTGCAATAA
AATTACGTGAATCAAAAATTGAAAAAAAAAAAAAAAA

RH15675.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:26:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG16713-RA 830 CG16713-RA 196..518 2..324 1615 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:54:40
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 3694556..3694759 321..118 1005 99.5 Minus
chr2L 23010047 chr2L 3694814..3694930 118..2 555 98.3 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:23:06 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:54:38
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3695029..3695235 324..118 1035 100 Minus
2L 23513712 2L 3695290..3695406 118..2 585 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:43:02
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3695029..3695235 324..118 1035 100 Minus
2L 23513712 2L 3695290..3695406 118..2 585 100 Minus
Blast to na_te.dros performed 2019-03-16 15:54:39
Subject Length Description Subject Range Query Range Score Percent Strand
accord 7404 accord ACCORD 7404bp 3314..3373 84..26 108 66.7 Minus

RH15675.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:55:43 Download gff for RH15675.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 3694556..3694758 119..321 99 <- Minus
chr2L 3694814..3694930 1..118 97   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:52:04 Download gff for RH15675.complete
Subject Subject Range Query Range Percent Splice Strand
CG16713-RA 1..249 52..300 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:39:17 Download gff for RH15675.complete
Subject Subject Range Query Range Percent Splice Strand
CG16713-RA 1..249 52..300 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:20:33 Download gff for RH15675.complete
Subject Subject Range Query Range Percent Splice Strand
CG16713-RA 1..249 52..300 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:49:42 Download gff for RH15675.complete
Subject Subject Range Query Range Percent Splice Strand
CG16713-RA 1..249 52..300 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-03-10 11:11:18 Download gff for RH15675.complete
Subject Subject Range Query Range Percent Splice Strand
CG16713-RA 1..320 2..321 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:39:17 Download gff for RH15675.complete
Subject Subject Range Query Range Percent Splice Strand
CG16713-RA 1..320 2..321 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:20:33 Download gff for RH15675.complete
Subject Subject Range Query Range Percent Splice Strand
CG16713-RA 4..325 1..321 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:49:42 Download gff for RH15675.complete
Subject Subject Range Query Range Percent Splice Strand
CG16713-RA 4..325 1..321 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:55:43 Download gff for RH15675.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3695032..3695234 119..321 100 <- Minus
2L 3695290..3695406 1..118 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:55:43 Download gff for RH15675.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3695032..3695234 119..321 100 <- Minus
2L 3695290..3695406 1..118 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:55:43 Download gff for RH15675.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3695032..3695234 119..321 100 <- Minus
2L 3695290..3695406 1..118 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:20:33 Download gff for RH15675.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 3695032..3695234 119..321 100 <- Minus
arm_2L 3695290..3695406 1..118 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:13:19 Download gff for RH15675.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3695032..3695234 119..321 100 <- Minus
2L 3695290..3695406 1..118 99   Minus

RH15675.pep Sequence

Translation from 51 to 299

> RH15675.pep
MKLLILVFVFVAFVANALALKNAICGLPHSLNGDGRISCEAYIPSWSYDA
DRNECVKFIYGGCGGNNNRFNSREICEDKCLQ*

RH15675.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:15:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19682-PA 82 GF19682-PA 1..82 1..82 301 67.1 Plus
Dana\GF14655-PA 81 GF14655-PA 1..80 1..81 279 65.4 Plus
Dana\GF14654-PA 82 GF14654-PA 1..82 1..82 217 47.6 Plus
Dana\GF15247-PA 82 GF15247-PA 17..82 17..82 203 54.5 Plus
Dana\GF14656-PA 88 GF14656-PA 1..86 6..80 159 38.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:15:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24413-PA 82 GG24413-PA 1..82 1..82 371 85.4 Plus
Dere\GG24411-PA 78 GG24411-PA 1..78 1..82 280 63.4 Plus
Dere\GG24416-PA 78 GG24416-PA 1..78 1..82 254 58.5 Plus
Dere\GG24417-PA 78 GG24417-PA 1..78 1..82 243 57.3 Plus
Dere\GG16686-PA 84 GG16686-PA 1..84 1..82 240 53.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 13:15:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH25268-PA 83 GH25268-PA 1..82 1..81 279 62.2 Plus
Dgri\GH22481-PA 83 GH22481-PA 1..82 1..81 278 62.2 Plus
Dgri\GH13181-PA 83 GH13181-PA 1..82 1..81 278 62.2 Plus
Dgri\GH13184-PA 94 GH13184-PA 1..76 1..75 251 61.8 Plus
Dgri\GH13180-PA 81 GH13180-PA 1..81 1..81 227 49.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:01:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG16713-PA 82 CG16713-PA 1..82 1..82 446 100 Plus
IM33-PB 82 CG16712-PB 1..80 1..80 253 56.2 Plus
IM33-PA 82 CG16712-PA 1..80 1..80 253 56.2 Plus
Acp24A4-PC 78 CG31779-PC 1..78 1..82 245 57.3 Plus
Acp24A4-PB 78 CG31779-PB 1..78 1..82 245 57.3 Plus
CG42464-PA 87 CG42464-PA 7..80 8..80 179 45.9 Plus
CG43165-PA 95 CG43165-PA 1..80 1..80 171 42.5 Plus
CG16704-PB 79 CG16704-PB 1..77 1..80 169 43.2 Plus
CG16704-PA 79 CG16704-PA 1..77 1..80 169 43.2 Plus
CG3513-PA 88 CG3513-PA 3..86 10..80 168 40 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 13:15:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17758-PA 82 GI17758-PA 1..82 1..82 267 57.3 Plus
Dmoj\GI17759-PA 82 GI17759-PA 18..82 18..82 256 67.7 Plus
Dmoj\GI17757-PA 82 GI17757-PA 1..82 1..82 230 50 Plus
Dmoj\GI23877-PA 82 GI23877-PA 1..82 1..82 221 51.2 Plus
Dmoj\GI17762-PA 86 GI17762-PA 6..84 4..80 173 41.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:15:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19462-PA 82 GL19462-PA 1..82 1..82 286 69.5 Plus
Dper\GL19460-PA 80 GL19460-PA 1..80 1..82 272 64.6 Plus
Dper\GL19459-PA 82 GL19459-PA 1..82 1..82 220 47.6 Plus
Dper\GL19461-PA 78 GL19461-PA 1..78 1..82 192 50 Plus
Dper\GL19427-PA 78 GL19427-PA 1..78 1..82 192 43.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:15:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25971-PA 82 GA25971-PA 1..82 1..82 285 69.5 Plus
Dpse\GA25969-PA 80 GA25969-PA 1..80 1..82 265 63.4 Plus
Dpse\GA14098-PA 82 GA14098-PA 1..82 1..82 227 48.8 Plus
Dpse\GA25970-PA 78 GA25970-PA 1..78 1..82 192 51.2 Plus
Dpse\GA25956-PA 78 GA25956-PA 1..78 1..82 185 43.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:15:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18128-PA 82 GM18128-PA 1..82 1..82 406 93.9 Plus
Dsec\GM18127-PA 82 GM18127-PA 1..82 1..82 247 54.9 Plus
Dsec\GM18130-PA 88 GM18130-PA 3..86 10..80 166 38.1 Plus
Dsec\GM18131-PA 78 GM18131-PA 1..76 1..80 161 45.7 Plus
Dsec\GM18129-PA 107 GM18129-PA 44..107 15..82 138 42.6 Plus
Dsec\GM18129-PA 107 GM18129-PA 5..51 24..74 130 51 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:15:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22735-PA 82 GD22735-PA 1..82 1..82 406 93.9 Plus
Dsim\GD22734-PA 82 GD22734-PA 1..82 1..82 247 54.9 Plus
Dsim\Acp24A4-PA 78 GD22736-PA 1..78 1..82 226 54.9 Plus
Dsim\GD22737-PA 88 GD22737-PA 6..86 8..80 166 38.3 Plus
Dsim\GD22738-PA 86 GD22738-PA 1..68 1..71 132 41.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 13:15:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17586-PA 82 GJ17586-PA 1..82 1..82 320 68.3 Plus
Dvir\GJ17585-PA 82 GJ17585-PA 1..82 1..82 238 50 Plus
Dvir\GJ21125-PA 80 GJ21125-PA 1..80 1..82 236 53.7 Plus
Dvir\GJ16348-PA 86 GJ16348-PA 4..84 2..80 172 38.3 Plus
Dvir\GJ16350-PA 79 GJ16350-PA 20..77 19..80 135 43.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 13:15:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15469-PA 80 GK15469-PA 1..78 1..80 287 67.5 Plus
Dwil\GK15471-PA 90 GK15471-PA 25..88 19..80 181 50 Plus
Dwil\GK15472-PA 79 GK15472-PA 1..77 1..80 146 40.7 Plus
Dwil\GK10999-PA 2909 GK10999-PA 1671..1722 24..80 145 49.1 Plus
Dwil\GK18965-PA 79 GK18965-PA 1..77 1..80 140 35.8 Plus
Dwil\GK10999-PA 2909 GK10999-PA 2007..2049 38..80 137 46.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:15:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14816-PA 82 GE14816-PA 1..82 1..82 385 86.6 Plus
Dyak\GE17972-PA 84 GE17972-PA 1..84 1..82 257 69 Plus
Dyak\GE14815-PA 82 GE14815-PA 1..82 1..82 216 51.2 Plus
Dyak\GE14817-PA 106 GE14817-PA 21..104 10..80 164 38.1 Plus
Dyak\GE14820-PA 83 GE14820-PA 1..77 1..80 150 42 Plus

RH15675.hyp Sequence

Translation from 51 to 299

> RH15675.hyp
MKLLILVFVFVAFVANALALKNAICGLPHSLNGDGRISCEAYIPSWSYDA
DRNECVKFIYGGCGGNNNRFNSREICEDKCLQ*

RH15675.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:57:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG16713-PA 82 CG16713-PA 1..82 1..82 446 100 Plus
CG16712-PB 82 CG16712-PB 1..80 1..80 253 56.2 Plus
CG16712-PA 82 CG16712-PA 1..80 1..80 253 56.2 Plus
Acp24A4-PC 78 CG31779-PC 1..78 1..82 245 57.3 Plus
Acp24A4-PB 78 CG31779-PB 1..78 1..82 245 57.3 Plus