Clone RH16027 Report

Search the DGRC for RH16027

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:160
Well:27
Vector:pFlc-1
Associated Gene/TranscriptCG42319-RA
Protein status:RH16027.pep: gold
Preliminary Size:756
Sequenced Size:985

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17041 2001-12-13 Blastp of sequenced clone
CG17041 2002-01-01 Sim4 clustering to Release 2
CG17041 2003-01-01 Sim4 clustering to Release 3
CG17041 2008-04-29 Release 5.5 accounting
CG42319 2008-08-15 Release 5.9 accounting
CG42319 2008-12-18 5.12 accounting

Clone Sequence Records

RH16027.complete Sequence

985 bp (985 high quality bases) assembled on 2001-12-13

GenBank Submission: AY070677

> RH16027.complete
GAATTGCGCCTCGAAACTCGCACGGTTACCCCCAACGGCCTGGCCGACAA
AGCGGGCATTCGCCTGGGCGACATCATACTCGAGATCAACGAGGAGGACG
CCTCGCAGCTGACGCTGTCCCAGGCCCACGAGAAAATCAACTCGACACCC
AAGAAGATACATTTCCTGCTGCGCAACATGGAGGAGGACGATCCCATGGG
CCAGTTTGAGGCTGGGGAGGAGAAGTCGATTGTGATGCGGGTTCCAAAGC
CTTTGCCGCCGCCCAGTGAATTCACCCCAACCCCCCTGCTTGGCTCGCGT
TGTTGGCATCCGATAATGTGGCAAGACCCTCCGGAGCCGCCGAAGCCCAA
GAAAAAGAAAACGAAAACGCAGCTGGACGACGAGGGCAACGAGGTGGTCA
TTGAGCTCAGCGAGGACGAGTCGTCCGACGAGGAGGAGCAGGAGCTGCCC
CACCATCGCATCATCCGGAACATCCGGCGATTCTTTGCGGAGGTGGGCGA
CAACCAGGAGCTGCGCACGAACACCATTGAGAACATGCTGATGGCCCTGC
CCAGCGCCTCCAAGGCCAAGTGAGGAGCCGTTCACCCAGCTAACCGGCTT
ATCCCTGGCAGCAGAAGCTGTCGCATCCCTACACCTGCACTGAGAAAAAA
TGCCAGTCAAAAGTTTTTATTACCCACCAAATATGTAAAAGATATAATGT
TTAGTTCAGTGTAAACATTTTGAAATGAAATTTCTTTAAATATAATTTAT
AGCTGCAAATTACTAGTTAGAATCTTTTTCAAGATAGAGAATGAAGCATT
TCAAATGTTCAAAATTGTTCTATCTATAAATTACAATCTCAGATAATAAA
TAGTCTTGATTTAGATGAAGCTTTTCCCCTGTGTAGAGTTCCCTAACTCT
TTCATACTTGTACATAATTTTGAATATTTCGTGTCTGTTTTTGTCGCTTT
AATAAAAAGAAACCCCCCGAAAAAAAAAAAAAAAA

RH16027.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:48:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG42319-RA 1228 CG42319-RA 108..1079 2..973 4860 100 Plus
CG42319.b 1727 CG42319.b 108..1079 2..973 4860 100 Plus
CG42319-RB 1216 CG42319-RB 85..1035 23..973 4755 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:03:52
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 9151157..9151687 439..969 2655 100 Plus
chr2R 21145070 chr2R 9150852..9151026 268..442 845 98.9 Plus
chr2R 21145070 chr2R 9150002..9150154 24..176 765 100 Plus
chr2R 21145070 chr2R 9150261..9150357 172..268 470 99 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:23:10 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:03:50
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 13263797..13264331 439..973 2675 100 Plus
2R 25286936 2R 13263492..13263666 268..442 875 100 Plus
2R 25286936 2R 13262642..13262794 24..176 765 100 Plus
2R 25286936 2R 13262901..13262997 172..268 470 99 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:14:37
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 13264996..13265530 439..973 2675 100 Plus
2R 25260384 2R 13264691..13264865 268..442 875 100 Plus
2R 25260384 2R 13263841..13263993 24..176 765 100 Plus
2R 25260384 2R 13264100..13264196 172..268 470 98.9 Plus
Blast to na_te.dros performed 2019-03-16 07:03:51
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy2 6841 gypsy2 GYPSY2 6841bp 887..973 783..872 118 66.7 Plus
Transpac 5249 Transpac 5249bp Derived from AF222049 (AF222049.1) (Rel. 62, Last updated, Version 1). 3137..3225 685..774 115 62 Plus
Doc2-element 4789 Doc2-element DOC2 4789bp 1206..1280 739..817 114 65.8 Plus

RH16027.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:04:28 Download gff for RH16027.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 9149844..9149867 1..24 95 -> Plus
chr2R 9150003..9150154 25..176 100 -> Plus
chr2R 9150266..9150357 177..268 100 -> Plus
chr2R 9150853..9151025 269..441 98 -> Plus
chr2R 9151160..9151687 442..969 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:42:17 Download gff for RH16027.complete
Subject Subject Range Query Range Percent Splice Strand
CG42319-RD 203..756 18..573 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:16:43 Download gff for RH16027.complete
Subject Subject Range Query Range Percent Splice Strand
CG42319-RD 203..756 18..573 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:43:22 Download gff for RH16027.complete
Subject Subject Range Query Range Percent Splice Strand
CG42319-RD 203..756 18..573 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:42:50 Download gff for RH16027.complete
Subject Subject Range Query Range Percent Splice Strand
CG42319-RD 203..756 18..573 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:26:30 Download gff for RH16027.complete
Subject Subject Range Query Range Percent Splice Strand
CG42319-RD 203..756 18..573 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:49:09 Download gff for RH16027.complete
Subject Subject Range Query Range Percent Splice Strand
CG42319-RA 2..969 2..969 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:16:43 Download gff for RH16027.complete
Subject Subject Range Query Range Percent Splice Strand
CG42319-RA 2..969 2..969 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:43:22 Download gff for RH16027.complete
Subject Subject Range Query Range Percent Splice Strand
CG42319-RA 1..968 2..969 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:42:51 Download gff for RH16027.complete
Subject Subject Range Query Range Percent Splice Strand
CG42319-RA 2..969 2..969 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:26:30 Download gff for RH16027.complete
Subject Subject Range Query Range Percent Splice Strand
CG42319-RA 1..968 2..969 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:04:28 Download gff for RH16027.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13262484..13262507 1..24 95 -> Plus
2R 13262643..13262794 25..176 100 -> Plus
2R 13262906..13262997 177..268 100 -> Plus
2R 13263493..13263665 269..441 100 -> Plus
2R 13263800..13264327 442..969 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:04:28 Download gff for RH16027.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13262484..13262507 1..24 95 -> Plus
2R 13262643..13262794 25..176 100 -> Plus
2R 13262906..13262997 177..268 100 -> Plus
2R 13263493..13263665 269..441 100 -> Plus
2R 13263800..13264327 442..969 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:04:28 Download gff for RH16027.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13262484..13262507 1..24 95 -> Plus
2R 13262643..13262794 25..176 100 -> Plus
2R 13262906..13262997 177..268 100 -> Plus
2R 13263493..13263665 269..441 100 -> Plus
2R 13263800..13264327 442..969 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:43:22 Download gff for RH16027.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 9150148..9150299 25..176 100 -> Plus
arm_2R 9150411..9150502 177..268 100 -> Plus
arm_2R 9150998..9151170 269..441 100 -> Plus
arm_2R 9149989..9150012 1..24 95 -> Plus
arm_2R 9151305..9151832 442..969 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:18:56 Download gff for RH16027.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13264999..13265526 442..969 100   Plus
2R 13263683..13263706 1..24 95 -> Plus
2R 13263842..13263993 25..176 100 -> Plus
2R 13264105..13264196 177..268 100 -> Plus
2R 13264692..13264864 269..441 100 -> Plus

RH16027.hyp Sequence

Translation from 0 to 572

> RH16027.hyp
QLRLETRTVTPNGLADKAGIRLGDIILEINEEDASQLTLSQAHEKINSTP
KKIHFLLRNMEEDDPMGQFEAGEEKSIVMRVPKPLPPPSEFTPTPLLGSR
CWHPIMWQDPPEPPKPKKKKTKTQLDDEGNEVVIELSEDESSDEEEQELP
HHRIIRNIRRFFAEVGDNQELRTNTIENMLMALPSASKAK*

RH16027.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:11:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG42319-PD 251 CG17041-PD 70..251 9..190 955 100 Plus
CG42319-PC 131 CG17041-PC 1..131 60..190 700 100 Plus
CG42319-PB 131 CG17041-PB 1..131 60..190 700 100 Plus
CG42319-PA 131 CG17041-PA 1..131 60..190 700 100 Plus
CG42319-PE 452 CG17042-PA 70..150 9..89 415 100 Plus

RH16027.pep Sequence

Translation from 177 to 572

> RH16027.pep
MEEDDPMGQFEAGEEKSIVMRVPKPLPPPSEFTPTPLLGSRCWHPIMWQD
PPEPPKPKKKKTKTQLDDEGNEVVIELSEDESSDEEEQELPHHRIIRNIR
RFFAEVGDNQELRTNTIENMLMALPSASKAK*

RH16027.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:33:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13686-PA 251 GF13686-PA 121..251 1..131 490 93.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:33:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20373-PA 251 GG20373-PA 121..251 1..131 678 98.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:33:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21623-PA 252 GH21623-PA 121..250 1..130 493 86.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:36:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG42319-PC 131 CG17041-PC 1..131 1..131 700 100 Plus
CG42319-PB 131 CG17041-PB 1..131 1..131 700 100 Plus
CG42319-PA 131 CG17041-PA 1..131 1..131 700 100 Plus
CG42319-PD 251 CG17041-PD 121..251 1..131 700 100 Plus
CG42319-PF 332 CG42319-PF 1..30 1..30 160 100 Plus
CG42319-PE 452 CG17042-PA 121..150 1..30 160 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:33:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20077-PA 131 GI20077-PA 1..131 1..131 465 89.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:33:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11005-PA 131 GL11005-PA 1..131 1..131 468 90.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:33:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14289-PA 131 GA14289-PA 1..131 1..131 468 90.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:33:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21461-PA 251 GM21461-PA 121..251 1..131 684 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:33:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10959-PA 251 GD10959-PA 121..251 1..131 684 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:33:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21170-PA 251 GJ21170-PA 121..251 1..131 469 87 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:33:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17980-PA 252 GK17980-PA 123..252 2..131 459 91.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:33:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12535-PA 251 GE12535-PA 121..251 1..131 681 99.2 Plus