Clone RH16169 Report

Search the DGRC for RH16169

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:161
Well:69
Vector:pFlc-1
Associated Gene/TranscriptNplp3-RA
Protein status:RH16169.pep: gold
Preliminary Size:512
Sequenced Size:552

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13061 2002-01-01 Sim4 clustering to Release 2
CG13061 2002-04-26 Blastp of sequenced clone
CG13061 2003-01-01 Sim4 clustering to Release 3
Nplp3 2008-04-29 Release 5.5 accounting
Nplp3 2008-08-15 Release 5.9 accounting
Nplp3 2008-12-18 5.12 accounting

Clone Sequence Records

RH16169.complete Sequence

552 bp (552 high quality bases) assembled on 2002-04-26

GenBank Submission: AY113570

> RH16169.complete
GGTCAAATCGTTGCAAACCATCAACAAAACAAAATGTTCAAGCTGTGCGT
CTTCGTTGCTCTCCTTAGCCTGGCTGCTGCTGCCCCAGCTCCCGCTCCTG
CTCCTGCTCCTGCTCCTGGTCTCATTGGCCCTGGCATTGTGGCACCTGGA
ATCTGGGGACCCACCGTTGTCGGATCTCCTCTGCTTGCTCCTCAGGTGGT
GAGCGTGGTGCCCGGTGCCATTTCTCATGCTGCCATCACCCAGGTGCATC
CTTCTCCTCTGCTGATCAAGAGCGTCCATGGCCTGGGACCAGTTGTGATC
GGTTAAACCAGTTACCCATTGGAGATCCAACCATCCATATAGCTCACCCA
CACGCCAGCCAATCAGCGCTCCTGTTCAACCATAACATTTCCTGCGGATT
ACTTCAACCACAAGTTCTGTGCCCTGTTTATAATGCAAGCAAATTCAGCA
ATGAGAAGGAAAAAATCACAAAAAAGTGTTTAGACACTAAAATACATTCC
AAGCAATAAATACCTACCATACATGTTATAGCGAGCGAAAAAAAAAAAAA
AA

RH16169.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:55:30
Subject Length Description Subject Range Query Range Score Percent Strand
Nplp3-RA 789 Nplp3-RA 199..740 2..543 2695 99.8 Plus
Nplp3.a 519 Nplp3.a 217..519 241..543 1500 99.6 Plus
Nplp3.a 519 Nplp3.a 26..222 2..198 985 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:03:14
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 16307943..16308440 45..537 2200 97.4 Plus
chr3L 24539361 chr3L 16307771..16307814 2..45 220 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:23:14 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:03:13
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16318198..16318696 45..543 2480 99.8 Plus
3L 28110227 3L 16318026..16318069 2..45 220 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:14:41
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 16311298..16311796 45..543 2480 99.7 Plus
3L 28103327 3L 16311126..16311169 2..45 220 100 Plus
Blast to na_te.dros performed on 2019-03-16 13:03:13 has no hits.

RH16169.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:04:13 Download gff for RH16169.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 16307770..16307814 1..45 97 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:42:19 Download gff for RH16169.complete
Subject Subject Range Query Range Percent Splice Strand
Nplp3-RA 1..273 34..306 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:53:13 Download gff for RH16169.complete
Subject Subject Range Query Range Percent Splice Strand
Nplp3-RA 1..273 34..306 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:14:34 Download gff for RH16169.complete
Subject Subject Range Query Range Percent Splice Strand
Nplp3-RA 1..273 34..306 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:35:39 Download gff for RH16169.complete
Subject Subject Range Query Range Percent Splice Strand
Nplp3-RA 1..273 34..306 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:12:23 Download gff for RH16169.complete
Subject Subject Range Query Range Percent Splice Strand
Nplp3-RA 1..273 34..306 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:05:18 Download gff for RH16169.complete
Subject Subject Range Query Range Percent Splice Strand
Nplp3-RA 2..537 2..537 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:53:13 Download gff for RH16169.complete
Subject Subject Range Query Range Percent Splice Strand
Nplp3-RA 2..538 1..537 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:14:34 Download gff for RH16169.complete
Subject Subject Range Query Range Percent Splice Strand
Nplp3-RA 2..538 1..537 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:35:39 Download gff for RH16169.complete
Subject Subject Range Query Range Percent Splice Strand
Nplp3-RA 2..537 2..537 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:12:23 Download gff for RH16169.complete
Subject Subject Range Query Range Percent Splice Strand
Nplp3-RA 2..538 1..537 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:04:13 Download gff for RH16169.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16318025..16318069 1..45 97 -> Plus
3L 16318199..16318690 46..537 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:04:13 Download gff for RH16169.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16318025..16318069 1..45 97 -> Plus
3L 16318199..16318690 46..537 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:04:13 Download gff for RH16169.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16318025..16318069 1..45 97 -> Plus
3L 16318199..16318690 46..537 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:14:34 Download gff for RH16169.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16311125..16311169 1..45 97 -> Plus
arm_3L 16311299..16311790 46..537 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:18:09 Download gff for RH16169.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16311299..16311790 46..537 99   Plus
3L 16311125..16311169 1..45 97 -> Plus

RH16169.hyp Sequence

Translation from 0 to 305

> RH16169.hyp
CQIVANHQQNKMFKLCVFVALLSLAAAAPAPAPAPAPAPGLIGPGIVAPG
IWGPTVVGSPLLAPQVVSVVPGAISHAAITQVHPSPLLIKSVHGLGPVVI
G*

RH16169.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:42:54
Subject Length Description Subject Range Query Range Score Percent Strand
Nplp3-PA 90 CG13061-PA 1..90 12..101 460 100 Plus

RH16169.pep Sequence

Translation from 33 to 305

> RH16169.pep
MFKLCVFVALLSLAAAAPAPAPAPAPAPGLIGPGIVAPGIWGPTVVGSPL
LAPQVVSVVPGAISHAAITQVHPSPLLIKSVHGLGPVVIG*

RH16169.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:49:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24180-PA 91 GF24180-PA 1..91 1..90 264 80 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:49:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15984-PA 94 GG15984-PA 1..94 1..90 306 91.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 13:49:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15875-PA 85 GH15875-PA 1..84 1..81 172 63.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:12:29
Subject Length Description Subject Range Query Range Score Percent Strand
Nplp3-PA 90 CG13061-PA 1..90 1..90 460 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:49:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12652-PA 84 GI12652-PA 1..83 1..81 151 65.1 Plus
Dmoj\GI16525-PA 84 GI16525-PA 1..83 1..81 151 65.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:49:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17850-PA 92 GL17850-PA 1..92 1..90 220 68.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:49:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12013-PA 90 GA12013-PA 1..90 1..90 222 74.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:49:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14621-PA 78 GD14621-PA 1..77 1..77 239 89.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:49:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12778-PA 90 GJ12778-PA 1..89 1..81 154 61.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:49:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16558-PA 86 GK16558-PA 1..86 1..90 250 78 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:49:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23099-PA 86 GE23099-PA 1..86 1..90 266 88.9 Plus
Dyak\Nplp3-PA 86 GE23179-PA 1..86 1..90 266 88.9 Plus