BDGP Sequence Production Resources |
Search the DGRC for RH16169
Library: | RH |
Tissue Source: | Drosophila melanogaster adult head |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2001-04-30 |
Comments: | Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 161 |
Well: | 69 |
Vector: | pFlc-1 |
Associated Gene/Transcript | Nplp3-RA |
Protein status: | RH16169.pep: gold |
Preliminary Size: | 512 |
Sequenced Size: | 552 |
Gene | Date | Evidence |
---|---|---|
CG13061 | 2002-01-01 | Sim4 clustering to Release 2 |
CG13061 | 2002-04-26 | Blastp of sequenced clone |
CG13061 | 2003-01-01 | Sim4 clustering to Release 3 |
Nplp3 | 2008-04-29 | Release 5.5 accounting |
Nplp3 | 2008-08-15 | Release 5.9 accounting |
Nplp3 | 2008-12-18 | 5.12 accounting |
552 bp (552 high quality bases) assembled on 2002-04-26
GenBank Submission: AY113570
> RH16169.complete GGTCAAATCGTTGCAAACCATCAACAAAACAAAATGTTCAAGCTGTGCGT CTTCGTTGCTCTCCTTAGCCTGGCTGCTGCTGCCCCAGCTCCCGCTCCTG CTCCTGCTCCTGCTCCTGGTCTCATTGGCCCTGGCATTGTGGCACCTGGA ATCTGGGGACCCACCGTTGTCGGATCTCCTCTGCTTGCTCCTCAGGTGGT GAGCGTGGTGCCCGGTGCCATTTCTCATGCTGCCATCACCCAGGTGCATC CTTCTCCTCTGCTGATCAAGAGCGTCCATGGCCTGGGACCAGTTGTGATC GGTTAAACCAGTTACCCATTGGAGATCCAACCATCCATATAGCTCACCCA CACGCCAGCCAATCAGCGCTCCTGTTCAACCATAACATTTCCTGCGGATT ACTTCAACCACAAGTTCTGTGCCCTGTTTATAATGCAAGCAAATTCAGCA ATGAGAAGGAAAAAATCACAAAAAAGTGTTTAGACACTAAAATACATTCC AAGCAATAAATACCTACCATACATGTTATAGCGAGCGAAAAAAAAAAAAA AA
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 16307770..16307814 | 1..45 | 97 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Nplp3-RA | 1..273 | 34..306 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Nplp3-RA | 1..273 | 34..306 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Nplp3-RA | 1..273 | 34..306 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Nplp3-RA | 1..273 | 34..306 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Nplp3-RA | 1..273 | 34..306 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Nplp3-RA | 2..537 | 2..537 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Nplp3-RA | 2..538 | 1..537 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Nplp3-RA | 2..538 | 1..537 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Nplp3-RA | 2..537 | 2..537 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Nplp3-RA | 2..538 | 1..537 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 16318025..16318069 | 1..45 | 97 | -> | Plus |
3L | 16318199..16318690 | 46..537 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 16318025..16318069 | 1..45 | 97 | -> | Plus |
3L | 16318199..16318690 | 46..537 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 16318025..16318069 | 1..45 | 97 | -> | Plus |
3L | 16318199..16318690 | 46..537 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 16311125..16311169 | 1..45 | 97 | -> | Plus |
arm_3L | 16311299..16311790 | 46..537 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 16311299..16311790 | 46..537 | 99 | Plus | |
3L | 16311125..16311169 | 1..45 | 97 | -> | Plus |
Translation from 0 to 305
> RH16169.hyp CQIVANHQQNKMFKLCVFVALLSLAAAAPAPAPAPAPAPGLIGPGIVAPG IWGPTVVGSPLLAPQVVSVVPGAISHAAITQVHPSPLLIKSVHGLGPVVI G*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Nplp3-PA | 90 | CG13061-PA | 1..90 | 12..101 | 460 | 100 | Plus |
Translation from 33 to 305
> RH16169.pep MFKLCVFVALLSLAAAAPAPAPAPAPAPGLIGPGIVAPGIWGPTVVGSPL LAPQVVSVVPGAISHAAITQVHPSPLLIKSVHGLGPVVIG*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF24180-PA | 91 | GF24180-PA | 1..91 | 1..90 | 264 | 80 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG15984-PA | 94 | GG15984-PA | 1..94 | 1..90 | 306 | 91.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH15875-PA | 85 | GH15875-PA | 1..84 | 1..81 | 172 | 63.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Nplp3-PA | 90 | CG13061-PA | 1..90 | 1..90 | 460 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI12652-PA | 84 | GI12652-PA | 1..83 | 1..81 | 151 | 65.1 | Plus |
Dmoj\GI16525-PA | 84 | GI16525-PA | 1..83 | 1..81 | 151 | 65.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL17850-PA | 92 | GL17850-PA | 1..92 | 1..90 | 220 | 68.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA12013-PA | 90 | GA12013-PA | 1..90 | 1..90 | 222 | 74.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14621-PA | 78 | GD14621-PA | 1..77 | 1..77 | 239 | 89.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ12778-PA | 90 | GJ12778-PA | 1..89 | 1..81 | 154 | 61.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK16558-PA | 86 | GK16558-PA | 1..86 | 1..90 | 250 | 78 | Plus |