Clone RH16331 Report

Search the DGRC for RH16331

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:163
Well:31
Vector:pFlc-1
Associated Gene/TranscriptCG5791-RA
Protein status:RH16331.pep: gold
Preliminary Size:333
Sequenced Size:414

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5791 2001-12-17 Blastp of sequenced clone
CG5791 2002-01-01 Sim4 clustering to Release 2
CG5791 2003-01-01 Sim4 clustering to Release 3
CG5791 2008-04-29 Release 5.5 accounting
CG5791 2008-08-15 Release 5.9 accounting
CG5791 2008-12-18 5.12 accounting

Clone Sequence Records

RH16331.complete Sequence

414 bp (414 high quality bases) assembled on 2001-12-17

GenBank Submission: AY071696

> RH16331.complete
GATCGAATCAAGTGCCGGACTATATAAGTAGCGTGAGAGTCGATACGGTC
ATCTATCTATCGGCTTTAATATGAAGTACCTGACGTGTGTGCTGCTCCCG
TTGGCTTTAATTCCGACTCTGATCGGCGCTCATCCCAGCACAGTGGTGGT
GAATGGCGTCTGTCTGACTTGTCCCAATCCGAATGGTGAACCCGTCTACC
TGGATGGCCAGCAGTACCGCAGCTTCTCCTCATCCCCTGGCGATGGTAAT
GTGGTCATTTCCCGTGGAAATGACGGTAGTGGCGGTGGAGGTGGCACCAT
TTACCGGAGGGGTGGTAATACCATCGTCAATGGCAGATGTCAGCACTGCA
ACGTGGATCCCTATTAAAGGCTTAAACAATAGAGTCTGAATATTGAATTA
AAAAAAAAAAAAAA

RH16331.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:56:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG5791-RA 629 CG5791-RA 59..461 1..403 2000 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:53:21
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 17911154..17911382 171..399 1085 98.3 Plus
chr3R 27901430 chr3R 17910864..17910991 1..128 640 100 Plus
chr3R 27901430 chr3R 17911048..17911092 128..172 225 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:23:17 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:53:19
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 22087429..22087661 171..403 1150 99.6 Plus
3R 32079331 3R 22087133..22087260 1..128 640 100 Plus
3R 32079331 3R 22087317..22087361 128..172 225 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:15:56
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 21828260..21828492 171..403 1150 99.5 Plus
3R 31820162 3R 21827964..21828091 1..128 640 100 Plus
3R 31820162 3R 21828148..21828192 128..172 225 100 Plus
Blast to na_te.dros performed on 2019-03-15 22:53:20 has no hits.

RH16331.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:54:00 Download gff for RH16331.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 17910864..17910991 1..128 100 -> Plus
chr3R 17911049..17911090 129..170 100 -> Plus
chr3R 17911154..17911382 171..399 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:42:22 Download gff for RH16331.complete
Subject Subject Range Query Range Percent Splice Strand
CG5791-RA 1..297 71..367 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:55:16 Download gff for RH16331.complete
Subject Subject Range Query Range Percent Splice Strand
CG5791-RA 1..297 71..367 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:35:40 Download gff for RH16331.complete
Subject Subject Range Query Range Percent Splice Strand
CG5791-RA 1..297 71..367 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:37:49 Download gff for RH16331.complete
Subject Subject Range Query Range Percent Splice Strand
CG5791-RA 1..297 71..367 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:37:42 Download gff for RH16331.complete
Subject Subject Range Query Range Percent Splice Strand
CG5791-RA 1..297 71..367 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:08:33 Download gff for RH16331.complete
Subject Subject Range Query Range Percent Splice Strand
CG5791-RA 1..399 1..399 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:55:16 Download gff for RH16331.complete
Subject Subject Range Query Range Percent Splice Strand
CG5791-RA 1..399 1..399 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:35:40 Download gff for RH16331.complete
Subject Subject Range Query Range Percent Splice Strand
CG5791-RA 1..399 1..399 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:37:49 Download gff for RH16331.complete
Subject Subject Range Query Range Percent Splice Strand
CG5791-RA 1..399 1..399 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:37:42 Download gff for RH16331.complete
Subject Subject Range Query Range Percent Splice Strand
CG5791-RB 59..457 1..399 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:54:00 Download gff for RH16331.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22087429..22087657 171..399 99   Plus
3R 22087318..22087359 129..170 100 -> Plus
3R 22087133..22087260 1..128 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:54:00 Download gff for RH16331.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22087429..22087657 171..399 99   Plus
3R 22087318..22087359 129..170 100 -> Plus
3R 22087133..22087260 1..128 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:54:00 Download gff for RH16331.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22087429..22087657 171..399 99   Plus
3R 22087318..22087359 129..170 100 -> Plus
3R 22087133..22087260 1..128 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:35:40 Download gff for RH16331.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 17913040..17913081 129..170 100 -> Plus
arm_3R 17912855..17912982 1..128 100 -> Plus
arm_3R 17913151..17913379 171..399 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:20:42 Download gff for RH16331.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21828260..21828488 171..399 99   Plus
3R 21827964..21828091 1..128 100 -> Plus
3R 21828149..21828190 129..170 100 -> Plus

RH16331.pep Sequence

Translation from 70 to 366

> RH16331.pep
MKYLTCVLLPLALIPTLIGAHPSTVVVNGVCLTCPNPNGEPVYLDGQQYR
SFSSSPGDGNVVISRGNDGSGGGGGTIYRRGGNTIVNGRCQHCNVDPY*

RH16331.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:18:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18068-PA 170 GF18068-PA 1..103 1..94 264 67 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:18:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11106-PA 98 GG11106-PA 1..98 1..98 356 92.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:18:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21020-PA 97 GH21020-PA 1..96 1..96 261 65.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:23:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG5791-PB 98 CG5791-PB 1..98 1..98 539 100 Plus
CG5791-PC 98 CG5791-PC 1..98 1..98 539 100 Plus
CG5791-PA 98 CG5791-PA 1..98 1..98 539 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:18:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10460-PA 91 GI10460-PA 1..90 1..96 244 63.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:18:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23659-PA 94 GL23659-PA 1..93 1..96 244 76.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:18:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19132-PA 104 GA19132-PA 1..103 1..96 273 71.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:18:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26400-PA 98 GM26400-PA 1..98 1..98 319 95.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:18:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15173-PA 98 GD15173-PA 1..98 1..98 483 96.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:18:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23146-PA 91 GJ23146-PA 1..90 1..96 250 68.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:18:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14243-PA 99 GK14243-PA 23..99 18..97 227 73.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:18:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10268-PA 98 GE10268-PA 1..98 1..98 311 93.9 Plus

RH16331.hyp Sequence

Translation from 70 to 366

> RH16331.hyp
MKYLTCVLLPLALIPTLIGAHPSTVVVNGVCLTCPNPNGEPVYLDGQQYR
SFSSSPGDGNVVISRGNDGSGGGGGTIYRRGGNTIVNGRCQHCNVDPY*

RH16331.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:43:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG5791-PB 98 CG5791-PB 1..98 1..98 539 100 Plus
CG5791-PC 98 CG5791-PC 1..98 1..98 539 100 Plus
CG5791-PA 98 CG5791-PA 1..98 1..98 539 100 Plus