BDGP Sequence Production Resources |
Search the DGRC for RH16331
Library: | RH |
Tissue Source: | Drosophila melanogaster adult head |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2001-04-30 |
Comments: | Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 163 |
Well: | 31 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG5791-RA |
Protein status: | RH16331.pep: gold |
Preliminary Size: | 333 |
Sequenced Size: | 414 |
Gene | Date | Evidence |
---|---|---|
CG5791 | 2001-12-17 | Blastp of sequenced clone |
CG5791 | 2002-01-01 | Sim4 clustering to Release 2 |
CG5791 | 2003-01-01 | Sim4 clustering to Release 3 |
CG5791 | 2008-04-29 | Release 5.5 accounting |
CG5791 | 2008-08-15 | Release 5.9 accounting |
CG5791 | 2008-12-18 | 5.12 accounting |
414 bp (414 high quality bases) assembled on 2001-12-17
GenBank Submission: AY071696
> RH16331.complete GATCGAATCAAGTGCCGGACTATATAAGTAGCGTGAGAGTCGATACGGTC ATCTATCTATCGGCTTTAATATGAAGTACCTGACGTGTGTGCTGCTCCCG TTGGCTTTAATTCCGACTCTGATCGGCGCTCATCCCAGCACAGTGGTGGT GAATGGCGTCTGTCTGACTTGTCCCAATCCGAATGGTGAACCCGTCTACC TGGATGGCCAGCAGTACCGCAGCTTCTCCTCATCCCCTGGCGATGGTAAT GTGGTCATTTCCCGTGGAAATGACGGTAGTGGCGGTGGAGGTGGCACCAT TTACCGGAGGGGTGGTAATACCATCGTCAATGGCAGATGTCAGCACTGCA ACGTGGATCCCTATTAAAGGCTTAAACAATAGAGTCTGAATATTGAATTA AAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG5791-RA | 629 | CG5791-RA | 59..461 | 1..403 | 2000 | 99.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 17911154..17911382 | 171..399 | 1085 | 98.3 | Plus |
chr3R | 27901430 | chr3R | 17910864..17910991 | 1..128 | 640 | 100 | Plus |
chr3R | 27901430 | chr3R | 17911048..17911092 | 128..172 | 225 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 22087429..22087661 | 171..403 | 1150 | 99.6 | Plus |
3R | 32079331 | 3R | 22087133..22087260 | 1..128 | 640 | 100 | Plus |
3R | 32079331 | 3R | 22087317..22087361 | 128..172 | 225 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 21828260..21828492 | 171..403 | 1150 | 99.5 | Plus |
3R | 31820162 | 3R | 21827964..21828091 | 1..128 | 640 | 100 | Plus |
3R | 31820162 | 3R | 21828148..21828192 | 128..172 | 225 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 17910864..17910991 | 1..128 | 100 | -> | Plus |
chr3R | 17911049..17911090 | 129..170 | 100 | -> | Plus |
chr3R | 17911154..17911382 | 171..399 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5791-RA | 1..297 | 71..367 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5791-RA | 1..297 | 71..367 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5791-RA | 1..297 | 71..367 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5791-RA | 1..297 | 71..367 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5791-RA | 1..297 | 71..367 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5791-RA | 1..399 | 1..399 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5791-RA | 1..399 | 1..399 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5791-RA | 1..399 | 1..399 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5791-RA | 1..399 | 1..399 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5791-RB | 59..457 | 1..399 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 22087429..22087657 | 171..399 | 99 | Plus | |
3R | 22087318..22087359 | 129..170 | 100 | -> | Plus |
3R | 22087133..22087260 | 1..128 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 22087429..22087657 | 171..399 | 99 | Plus | |
3R | 22087318..22087359 | 129..170 | 100 | -> | Plus |
3R | 22087133..22087260 | 1..128 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 22087429..22087657 | 171..399 | 99 | Plus | |
3R | 22087318..22087359 | 129..170 | 100 | -> | Plus |
3R | 22087133..22087260 | 1..128 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 17913040..17913081 | 129..170 | 100 | -> | Plus |
arm_3R | 17912855..17912982 | 1..128 | 100 | -> | Plus |
arm_3R | 17913151..17913379 | 171..399 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 21828260..21828488 | 171..399 | 99 | Plus | |
3R | 21827964..21828091 | 1..128 | 100 | -> | Plus |
3R | 21828149..21828190 | 129..170 | 100 | -> | Plus |
Translation from 70 to 366
> RH16331.pep MKYLTCVLLPLALIPTLIGAHPSTVVVNGVCLTCPNPNGEPVYLDGQQYR SFSSSPGDGNVVISRGNDGSGGGGGTIYRRGGNTIVNGRCQHCNVDPY*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF18068-PA | 170 | GF18068-PA | 1..103 | 1..94 | 264 | 67 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG11106-PA | 98 | GG11106-PA | 1..98 | 1..98 | 356 | 92.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH21020-PA | 97 | GH21020-PA | 1..96 | 1..96 | 261 | 65.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG5791-PB | 98 | CG5791-PB | 1..98 | 1..98 | 539 | 100 | Plus |
CG5791-PC | 98 | CG5791-PC | 1..98 | 1..98 | 539 | 100 | Plus |
CG5791-PA | 98 | CG5791-PA | 1..98 | 1..98 | 539 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI10460-PA | 91 | GI10460-PA | 1..90 | 1..96 | 244 | 63.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL23659-PA | 94 | GL23659-PA | 1..93 | 1..96 | 244 | 76.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA19132-PA | 104 | GA19132-PA | 1..103 | 1..96 | 273 | 71.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM26400-PA | 98 | GM26400-PA | 1..98 | 1..98 | 319 | 95.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD15173-PA | 98 | GD15173-PA | 1..98 | 1..98 | 483 | 96.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ23146-PA | 91 | GJ23146-PA | 1..90 | 1..96 | 250 | 68.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK14243-PA | 99 | GK14243-PA | 23..99 | 18..97 | 227 | 73.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE10268-PA | 98 | GE10268-PA | 1..98 | 1..98 | 311 | 93.9 | Plus |
Translation from 70 to 366
> RH16331.hyp MKYLTCVLLPLALIPTLIGAHPSTVVVNGVCLTCPNPNGEPVYLDGQQYR SFSSSPGDGNVVISRGNDGSGGGGGTIYRRGGNTIVNGRCQHCNVDPY*