Clone RH16335 Report

Search the DGRC for RH16335

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:163
Well:35
Vector:pFlc-1
Associated Gene/TranscriptCG32500-RA
Protein status:RH16335.pep: gold
Sequenced Size:1055

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG33502 2001-12-17 Blastp of sequenced clone
CG12798 2002-01-01 Sim4 clustering to Release 2
CG32857 2003-01-01 Sim4 clustering to Release 3
CG32820 2003-01-01 Sim4 clustering to Release 3
CG33502 2008-04-29 Release 5.5 accounting
CG33502 2008-08-15 Release 5.9 accounting
CG33502 2008-12-18 5.12 accounting

Clone Sequence Records

RH16335.complete Sequence

1055 bp (1055 high quality bases) assembled on 2001-12-17

GenBank Submission: AY071697

> RH16335.complete
GGTTTGTTTTCATTATCAAACGCAAAAGCGAACAATATGTCGAAATTTCT
GTCCCAAGCCGCCCTAAATACGCTGCGAAACACGCGCCTGGGGTCGCGGC
AACTGGTGCGCAGTTTTAAGGGCATCTCCAACACGCGTAACCATCGCATA
CCGGCTCACCAGGAATCGGGATGTGGTCACTCAGTGGGATGCGGGCTGCT
AGAGTTGCGGATGCCGGTGGCGTGCAGGAGGAGCATGTTCATCCAGACGC
AGGACACTCCGAATCCGGAGAGCTTGAAGTTCCTGCCCGGCGTGGACGTC
CTGGGAAAGGGGAACACGTACGACTTCCCCAACGGAACCACCGCCCACAA
CAGTCCTTTGGCCAAATTGCTGTTCCGCGTGGAGGGCGTTAAGGGCGTGT
TCTTTGGCGCCGACTTCGTCACCATCTCGAAGCAGGAGGGCGCCGAGTGG
AGCCTGATTAAGCCAGAGGTGTTTGCCGTCATAATGGACTTCTTTGCCAG
CGGCTTACCAGTTCTCAACGATGCCCAGCCCAATGCGGACACCGAGATCC
TCGAGGACGACGACGAGACGGTAATGATGATCAAGGAGCTGCTGGACACG
CGCATCCGACCCACCGTCCAGGAGGACGGCGGCGACATCGTCTTCATGGG
CTACGAGGGCGGCGTGGTCAAGCTAAAGATGCAAGGCTCCTGCTCCTCCT
GTCCCAGCTCCATTGTGACGCTGAAGAACGGAGTGCAGAACATGCTGCAA
TTCTACATACCGGAGGTGGAGTCCGTTGAGCAGGTCTTCGACGAGGCGGA
CAGGATGATCGAGAGCGAGTTTGAGCGCTTCGAAAAGAACCTCAAGACGC
TCAAGCAGCAGGAGCCCAGTGGCGGCGGTCCCCATTAGAGGGACTCATTT
TAATTTCCCTGCTTACGTTGCTAATTCGCTAGTGAAACCAATAGTTAGTT
GTATACATAACGTACATGTAGTTGATTACTTAAATAAATCTACGGCTTTA
AGCTTAACCGTTAGTGCATGAACCGATGTACAGAAACCCAAAAAAAAAAA
AAAAA

RH16335.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:37:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG32857-RA 1057 CG32857-RA 21..1056 2..1037 5180 100 Plus
CG32500-RA 1179 CG32500-RA 135..1170 2..1037 5180 100 Plus
CG33502-RA 1158 CG33502-RA 36..1071 2..1037 5180 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:03:32
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 21474517..21475193 1037..361 3385 100 Minus
chrX 22417052 chrX 21480609..21481285 1037..361 3385 100 Minus
chrX 22417052 chrX 21486701..21487377 1037..361 3385 100 Minus
chrX 22417052 chrX 21476244..21476500 361..105 1285 100 Minus
chrX 22417052 chrX 21482336..21482592 361..105 1285 100 Minus
chrX 22417052 chrX 21488444..21488700 361..105 1285 100 Minus
chrX 22417052 chrX 21476559..21476662 105..2 520 100 Minus
chrX 22417052 chrX 21482651..21482754 105..2 520 100 Minus
chrX 22417052 chrX 21488759..21488862 105..2 520 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:23:18 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:03:30
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 21609359..21610035 1037..361 3385 100 Minus
X 23542271 X 21615451..21616127 1037..361 3385 100 Minus
X 23542271 X 21621543..21622219 1037..361 3385 100 Minus
X 23542271 X 21611086..21611342 361..105 1285 100 Minus
X 23542271 X 21617178..21617434 361..105 1285 100 Minus
X 23542271 X 21623286..21623542 361..105 1285 100 Minus
X 23542271 X 21611401..21611504 105..2 520 100 Minus
X 23542271 X 21617493..21617596 105..2 520 100 Minus
X 23542271 X 21623601..21623704 105..2 520 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:04:49
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 21606635..21607311 1037..361 3385 100 Minus
X 23527363 X 21600543..21601219 1037..361 3385 100 Minus
X 23527363 X 21594451..21595127 1037..361 3385 100 Minus
X 23527363 X 21596178..21596434 361..105 1285 100 Minus
X 23527363 X 21608378..21608634 361..105 1285 100 Minus
X 23527363 X 21602270..21602526 361..105 1285 100 Minus
X 23527363 X 21602585..21602688 105..2 520 100 Minus
X 23527363 X 21596493..21596596 105..2 520 100 Minus
X 23527363 X 21608693..21608796 105..2 520 100 Minus
Blast to na_te.dros performed on 2019-03-16 13:03:31 has no hits.

RH16335.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:04:22 Download gff for RH16335.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 21476560..21476662 1..104 99   Minus
chrX 21476244..21476500 105..361 100 <- Minus
chrX 21474515..21475192 362..1039 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:42:23 Download gff for RH16335.complete
Subject Subject Range Query Range Percent Splice Strand
CG33502-RA 1..852 37..888 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:00:46 Download gff for RH16335.complete
Subject Subject Range Query Range Percent Splice Strand
CG32857-RA 1..852 37..888 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:14:42 Download gff for RH16335.complete
Subject Subject Range Query Range Percent Splice Strand
CG32500-RA 1..852 37..888 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:25:26 Download gff for RH16335.complete
Subject Subject Range Query Range Percent Splice Strand
CG33502-RA 1..852 37..888 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:12:33 Download gff for RH16335.complete
Subject Subject Range Query Range Percent Splice Strand
CG32500-RA 1..852 37..888 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:26:54 Download gff for RH16335.complete
Subject Subject Range Query Range Percent Splice Strand
CG33502-RA 1..1038 2..1039 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:00:46 Download gff for RH16335.complete
Subject Subject Range Query Range Percent Splice Strand
CG32857-RA 1..1036 2..1037 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:14:42 Download gff for RH16335.complete
Subject Subject Range Query Range Percent Splice Strand
CG32500-RA 46..1084 1..1039 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:25:26 Download gff for RH16335.complete
Subject Subject Range Query Range Percent Splice Strand
CG33502-RA 1..1038 2..1039 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:12:33 Download gff for RH16335.complete
Subject Subject Range Query Range Percent Splice Strand
CG32500-RA 46..1084 1..1039 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:04:22 Download gff for RH16335.complete
Subject Subject Range Query Range Percent Splice Strand
X 21609357..21610034 362..1039 99 <- Minus
X 21611086..21611342 105..361 100 <- Minus
X 21611402..21611504 1..104 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:04:22 Download gff for RH16335.complete
Subject Subject Range Query Range Percent Splice Strand
X 21609357..21610034 362..1039 99 <- Minus
X 21611086..21611342 105..361 100 <- Minus
X 21611402..21611504 1..104 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:04:22 Download gff for RH16335.complete
Subject Subject Range Query Range Percent Splice Strand
X 21609357..21610034 362..1039 99 <- Minus
X 21611086..21611342 105..361 100 <- Minus
X 21611402..21611504 1..104 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:14:42 Download gff for RH16335.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 21482429..21482531 1..104 99   Minus
arm_X 21480384..21481061 362..1039 99 <- Minus
arm_X 21482113..21482369 105..361 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:00:53 Download gff for RH16335.complete
Subject Subject Range Query Range Percent Splice Strand
X 21594449..21595126 362..1039 99 <- Minus
X 21596178..21596434 105..361 100 <- Minus
X 21596494..21596596 1..104 99   Minus

RH16335.hyp Sequence

Translation from 3 to 887

> RH16335.hyp
LFSLSNAKANNMSKFLSQAALNTLRNTRLGSRQLVRSFKGISNTRNHRIP
AHQESGCGHSVGCGLLELRMPVACRRSMFIQTQDTPNPESLKFLPGVDVL
GKGNTYDFPNGTTAHNSPLAKLLFRVEGVKGVFFGADFVTISKQEGAEWS
LIKPEVFAVIMDFFASGLPVLNDAQPNADTEILEDDDETVMMIKELLDTR
IRPTVQEDGGDIVFMGYEGGVVKLKMQGSCSSCPSSIVTLKNGVQNMLQF
YIPEVESVEQVFDEADRMIESEFERFEKNLKTLKQQEPSGGGPH*

RH16335.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:03:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG33502-PA 283 CG33502-PA 1..283 12..294 1468 100 Plus
CG32857-PA 283 CG32857-PA 1..283 12..294 1468 100 Plus
CG32500-PA 283 CG32500-PA 1..283 12..294 1468 100 Plus

RH16335.pep Sequence

Translation from 36 to 887

> RH16335.pep
MSKFLSQAALNTLRNTRLGSRQLVRSFKGISNTRNHRIPAHQESGCGHSV
GCGLLELRMPVACRRSMFIQTQDTPNPESLKFLPGVDVLGKGNTYDFPNG
TTAHNSPLAKLLFRVEGVKGVFFGADFVTISKQEGAEWSLIKPEVFAVIM
DFFASGLPVLNDAQPNADTEILEDDDETVMMIKELLDTRIRPTVQEDGGD
IVFMGYEGGVVKLKMQGSCSSCPSSIVTLKNGVQNMLQFYIPEVESVEQV
FDEADRMIESEFERFEKNLKTLKQQEPSGGGPH*

RH16335.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:15:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20932-PA 286 GF20932-PA 1..284 1..281 1127 74.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:15:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17526-PA 283 GG17526-PA 1..283 1..283 1414 93.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:15:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17809-PA 298 GH17809-PA 1..289 1..277 1005 66.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:10:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG32500-PA 283 CG32500-PA 1..283 1..283 1468 100 Plus
CG32857-PA 283 CG32857-PA 1..283 1..283 1468 100 Plus
CG33502-PA 283 CG33502-PA 1..283 1..283 1468 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:15:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14603-PA 259 GI14603-PA 36..243 63..270 975 86.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:15:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13432-PA 282 GL13432-PA 1..282 1..283 1083 74.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:15:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22888-PA 286 GA22888-PA 1..286 1..283 1060 73.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:15:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13534-PA 283 GM13534-PA 1..283 1..283 1439 95.4 Plus
Dsec\GM19271-PA 110 GM19271-PA 1..110 1..110 522 89.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:15:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15490-PA 283 GD15490-PA 1..283 1..283 1417 94.3 Plus
Dsim\GD12677-PA 175 GD12677-PA 1..175 109..283 898 97.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:15:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19011-PA 298 GJ19011-PA 1..277 1..269 1034 73 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:15:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25604-PA 289 GK25604-PA 1..287 1..282 1024 69.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:15:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15286-PA 283 GE15286-PA 1..283 1..283 1376 91.5 Plus