Clone RH16768 Report

Search the DGRC for RH16768

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:167
Well:68
Vector:pFlc-1
Associated Gene/TranscriptCG14881-RB
Protein status:RH16768.pep: gold
Preliminary Size:861
Sequenced Size:1044

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14881 2001-12-17 Blastp of sequenced clone
CG14881 2002-01-01 Sim4 clustering to Release 2
CG14881 2003-01-01 Sim4 clustering to Release 3
CG14881 2008-04-29 Release 5.5 accounting
CG14881 2008-08-15 Release 5.9 accounting
CG14881 2008-12-18 5.12 accounting

Clone Sequence Records

RH16768.complete Sequence

1044 bp (1044 high quality bases) assembled on 2001-12-17

GenBank Submission: AY071699

> RH16768.complete
GACTGATTTCAAATCGCAGCTTTGCCTTCGCATCCTTTTTATGTTCTCCA
GCCACAGGACATTGAAGAGGAGGACGCCTGCCCAGGGCATTGACCGCCGG
GAGTACATTGGTCACCTGGTCGATGAGTATTATACGACAACCAACATCGA
GGCCCAGCAGCAGGTGACTGCTAATTTGGCCAATTTTGCATACGATCCCA
TCAACTGGTCGCATCTCCTGGAGGCGGACGCCTTGGATGTATTTGTGGCA
TCGCTGGAGACACAGGATCAGCTATTAAAAGTGCACGGAATTGCGGCATT
GTGTAACCTTTGCCTGGACAAAACGGCTGCCAAATTTATCAGAGAGCAGC
TAAAACTGCTAACCGGCCTCTTTGTGCGCACTGATCACCCGGAAATAGTA
CTTCACAGCCTGGCGCTCTTTTACCAATTACTGGAATTTGGTGAACGGAC
TGAACGGGATTTACTTCTGAGCCCTGCGGTGCTAAGGACGGTGCAAGAGT
GGCGGGTCAAGGCCCACGATGAACGCATCGTTAAACTTTGTCAGTTGCTG
CTGCAAGATTTCGCAACACGCACAGAGGTTGTCCAGCTGCAAAAGGCTTC
CCCAAACGTTCCGACAGCTGAGCAGCAAAGCAGTGAAGCAGGTGCAAGTG
GTTAAGCGGTTTTCCCAAAGCGATTTGGAGCAGTTTGCCCAGTTCACCGG
CGACCACAACTACATCCATAGTCTGGAAACGCCCACCGAGGAGCGCCGCG
TCCATGGAGCCCTGCTCAACGCGGTGGTGGCTGGTATAATGGGTACCCAG
CTCCCTGGTCCGGGCACCGTGGTTCTAGAGCAGAATTTCAAGTTTCTGAA
ACCCTGTCGTATTGAGACCGACACCGTGGTGACCGTACGTCTGCTACAAT
CTCGCAAGATTTCCACCGTGGAGTACGATATAAGGCAGAACGACGAGGTG
GTGTTCGCCGGCAGCGCCAAGTTGCTGACTCGCAACTAAAAAGACTAGCT
TTGGTTCAATAAAAGTGGATGTTAGAATAAAAAAAAAAAAAAAA

RH16768.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:35:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG14881-RB 1158 CG14881-RB 105..1133 1..1029 5145 100 Plus
CG14881.a 1078 CG14881.a 27..1053 1..1029 5090 99.8 Plus
CG14881-RA 1070 CG14881-RA 105..633 1..529 2645 100 Plus
CG14881-RA 1070 CG14881-RA 634..1045 618..1029 2060 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:13:46
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 12260045..12260756 317..1028 3530 99.7 Plus
chr3R 27901430 chr3R 12259823..12259991 149..317 830 99.4 Plus
chr3R 27901430 chr3R 12259615..12259763 1..149 745 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:23:21 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:13:44
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 16435355..16436067 317..1029 3565 100 Plus
3R 32079331 3R 16435133..16435301 149..317 845 100 Plus
3R 32079331 3R 16434925..16435073 1..149 745 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:03:33
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 16176186..16176898 317..1029 3565 100 Plus
3R 31820162 3R 16175964..16176132 149..317 845 100 Plus
3R 31820162 3R 16175756..16175904 1..149 745 100 Plus
Blast to na_te.dros performed on 2019-03-16 07:13:44 has no hits.

RH16768.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:14:50 Download gff for RH16768.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 12259615..12259763 1..149 100 -> Plus
chr3R 12259824..12259991 150..317 99 -> Plus
chr3R 12260046..12260756 318..1028 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:42:27 Download gff for RH16768.complete
Subject Subject Range Query Range Percent Splice Strand
CG14881-RB 1..615 41..655 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:58:44 Download gff for RH16768.complete
Subject Subject Range Query Range Percent Splice Strand
CG14881-RB 1..615 41..655 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:43:40 Download gff for RH16768.complete
Subject Subject Range Query Range Percent Splice Strand
CG14881-RB 1..615 41..655 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:23:29 Download gff for RH16768.complete
Subject Subject Range Query Range Percent Splice Strand
CG14881-RB 1..615 41..655 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:27:54 Download gff for RH16768.complete
Subject Subject Range Query Range Percent Splice Strand
CG14881-RB 1..615 41..655 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:24:00 Download gff for RH16768.complete
Subject Subject Range Query Range Percent Splice Strand
CG14881-RB 1..1028 1..1028 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:58:44 Download gff for RH16768.complete
Subject Subject Range Query Range Percent Splice Strand
CG14881-RB 1..1028 1..1028 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:43:40 Download gff for RH16768.complete
Subject Subject Range Query Range Percent Splice Strand
CG14881-RB 27..1054 1..1028 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:23:29 Download gff for RH16768.complete
Subject Subject Range Query Range Percent Splice Strand
CG14881-RB 1..1028 1..1028 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:27:54 Download gff for RH16768.complete
Subject Subject Range Query Range Percent Splice Strand
CG14881-RB 27..1054 1..1028 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:14:50 Download gff for RH16768.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16434925..16435073 1..149 100 -> Plus
3R 16435134..16435301 150..317 100 -> Plus
3R 16435356..16436066 318..1028 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:14:50 Download gff for RH16768.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16434925..16435073 1..149 100 -> Plus
3R 16435134..16435301 150..317 100 -> Plus
3R 16435356..16436066 318..1028 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:14:50 Download gff for RH16768.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16434925..16435073 1..149 100 -> Plus
3R 16435134..16435301 150..317 100 -> Plus
3R 16435356..16436066 318..1028 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:43:40 Download gff for RH16768.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 12260647..12260795 1..149 100 -> Plus
arm_3R 12260856..12261023 150..317 100 -> Plus
arm_3R 12261078..12261788 318..1028 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:58:33 Download gff for RH16768.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16176187..16176897 318..1028 100   Plus
3R 16175756..16175904 1..149 100 -> Plus
3R 16175965..16176132 150..317 100 -> Plus

RH16768.hyp Sequence

Translation from 0 to 654

> RH16768.hyp
TDFKSQLCLRILFMFSSHRTLKRRTPAQGIDRREYIGHLVDEYYTTTNIE
AQQQVTANLANFAYDPINWSHLLEADALDVFVASLETQDQLLKVHGIAAL
CNLCLDKTAAKFIREQLKLLTGLFVRTDHPEIVLHSLALFYQLLEFGERT
ERDLLLSPAVLRTVQEWRVKAHDERIVKLCQLLLQDFATRTEVVQLQKAS
PNVPTAEQQSSEAGASG*

RH16768.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:04:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG14881-PB 204 CG14881-PB 1..204 14..217 1037 100 Plus
CG14881-PA 286 CG14881-PA 1..164 14..177 838 99.4 Plus

RH16768.pep Sequence

Translation from 40 to 654

> RH16768.pep
MFSSHRTLKRRTPAQGIDRREYIGHLVDEYYTTTNIEAQQQVTANLANFA
YDPINWSHLLEADALDVFVASLETQDQLLKVHGIAALCNLCLDKTAAKFI
REQLKLLTGLFVRTDHPEIVLHSLALFYQLLEFGERTERDLLLSPAVLRT
VQEWRVKAHDERIVKLCQLLLQDFATRTEVVQLQKASPNVPTAEQQSSEA
GASG*

RH16768.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 03:07:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18496-PA 304 GF18496-PA 1..202 1..203 768 70.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 03:07:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17002-PA 288 GG17002-PA 1..163 1..164 825 93.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 03:07:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19343-PA 302 GH19343-PA 1..204 1..204 648 60.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:29:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG14881-PB 204 CG14881-PB 1..204 1..204 1037 100 Plus
CG14881-PA 286 CG14881-PA 1..164 1..164 838 99.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 03:07:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22553-PA 214 GI22553-PA 1..203 1..204 630 56.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 03:07:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21607-PA 292 GL21607-PA 1..184 1..185 760 74.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 03:07:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13318-PB 208 GA13318-PB 1..208 1..204 789 69.9 Plus
Dpse\GA13318-PC 288 GA13318-PC 1..168 1..169 687 74 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 03:07:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15155-PA 289 GM15155-PA 1..164 1..164 834 93.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 03:07:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19099-PA 289 GD19099-PA 1..164 1..164 826 93.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 03:07:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23742-PA 291 GJ23742-PA 1..164 1..167 604 67.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 03:07:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13219-PA 268 GK13219-PA 1..146 1..147 595 75.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 03:07:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24395-PA 288 GE24395-PA 1..163 1..164 811 92.1 Plus