BDGP Sequence Production Resources |
Search the DGRC for RH16768
Library: | RH |
Tissue Source: | Drosophila melanogaster adult head |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2001-04-30 |
Comments: | Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 167 |
Well: | 68 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG14881-RB |
Protein status: | RH16768.pep: gold |
Preliminary Size: | 861 |
Sequenced Size: | 1044 |
Gene | Date | Evidence |
---|---|---|
CG14881 | 2001-12-17 | Blastp of sequenced clone |
CG14881 | 2002-01-01 | Sim4 clustering to Release 2 |
CG14881 | 2003-01-01 | Sim4 clustering to Release 3 |
CG14881 | 2008-04-29 | Release 5.5 accounting |
CG14881 | 2008-08-15 | Release 5.9 accounting |
CG14881 | 2008-12-18 | 5.12 accounting |
1044 bp (1044 high quality bases) assembled on 2001-12-17
GenBank Submission: AY071699
> RH16768.complete GACTGATTTCAAATCGCAGCTTTGCCTTCGCATCCTTTTTATGTTCTCCA GCCACAGGACATTGAAGAGGAGGACGCCTGCCCAGGGCATTGACCGCCGG GAGTACATTGGTCACCTGGTCGATGAGTATTATACGACAACCAACATCGA GGCCCAGCAGCAGGTGACTGCTAATTTGGCCAATTTTGCATACGATCCCA TCAACTGGTCGCATCTCCTGGAGGCGGACGCCTTGGATGTATTTGTGGCA TCGCTGGAGACACAGGATCAGCTATTAAAAGTGCACGGAATTGCGGCATT GTGTAACCTTTGCCTGGACAAAACGGCTGCCAAATTTATCAGAGAGCAGC TAAAACTGCTAACCGGCCTCTTTGTGCGCACTGATCACCCGGAAATAGTA CTTCACAGCCTGGCGCTCTTTTACCAATTACTGGAATTTGGTGAACGGAC TGAACGGGATTTACTTCTGAGCCCTGCGGTGCTAAGGACGGTGCAAGAGT GGCGGGTCAAGGCCCACGATGAACGCATCGTTAAACTTTGTCAGTTGCTG CTGCAAGATTTCGCAACACGCACAGAGGTTGTCCAGCTGCAAAAGGCTTC CCCAAACGTTCCGACAGCTGAGCAGCAAAGCAGTGAAGCAGGTGCAAGTG GTTAAGCGGTTTTCCCAAAGCGATTTGGAGCAGTTTGCCCAGTTCACCGG CGACCACAACTACATCCATAGTCTGGAAACGCCCACCGAGGAGCGCCGCG TCCATGGAGCCCTGCTCAACGCGGTGGTGGCTGGTATAATGGGTACCCAG CTCCCTGGTCCGGGCACCGTGGTTCTAGAGCAGAATTTCAAGTTTCTGAA ACCCTGTCGTATTGAGACCGACACCGTGGTGACCGTACGTCTGCTACAAT CTCGCAAGATTTCCACCGTGGAGTACGATATAAGGCAGAACGACGAGGTG GTGTTCGCCGGCAGCGCCAAGTTGCTGACTCGCAACTAAAAAGACTAGCT TTGGTTCAATAAAAGTGGATGTTAGAATAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG14881-RB | 1158 | CG14881-RB | 105..1133 | 1..1029 | 5145 | 100 | Plus |
CG14881.a | 1078 | CG14881.a | 27..1053 | 1..1029 | 5090 | 99.8 | Plus |
CG14881-RA | 1070 | CG14881-RA | 105..633 | 1..529 | 2645 | 100 | Plus |
CG14881-RA | 1070 | CG14881-RA | 634..1045 | 618..1029 | 2060 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 12260045..12260756 | 317..1028 | 3530 | 99.7 | Plus |
chr3R | 27901430 | chr3R | 12259823..12259991 | 149..317 | 830 | 99.4 | Plus |
chr3R | 27901430 | chr3R | 12259615..12259763 | 1..149 | 745 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 16435355..16436067 | 317..1029 | 3565 | 100 | Plus |
3R | 32079331 | 3R | 16435133..16435301 | 149..317 | 845 | 100 | Plus |
3R | 32079331 | 3R | 16434925..16435073 | 1..149 | 745 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 16176186..16176898 | 317..1029 | 3565 | 100 | Plus |
3R | 31820162 | 3R | 16175964..16176132 | 149..317 | 845 | 100 | Plus |
3R | 31820162 | 3R | 16175756..16175904 | 1..149 | 745 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 12259615..12259763 | 1..149 | 100 | -> | Plus |
chr3R | 12259824..12259991 | 150..317 | 99 | -> | Plus |
chr3R | 12260046..12260756 | 318..1028 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14881-RB | 1..615 | 41..655 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14881-RB | 1..615 | 41..655 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14881-RB | 1..615 | 41..655 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14881-RB | 1..615 | 41..655 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14881-RB | 1..615 | 41..655 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14881-RB | 1..1028 | 1..1028 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14881-RB | 1..1028 | 1..1028 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14881-RB | 27..1054 | 1..1028 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14881-RB | 1..1028 | 1..1028 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14881-RB | 27..1054 | 1..1028 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 16434925..16435073 | 1..149 | 100 | -> | Plus |
3R | 16435134..16435301 | 150..317 | 100 | -> | Plus |
3R | 16435356..16436066 | 318..1028 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 16434925..16435073 | 1..149 | 100 | -> | Plus |
3R | 16435134..16435301 | 150..317 | 100 | -> | Plus |
3R | 16435356..16436066 | 318..1028 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 16434925..16435073 | 1..149 | 100 | -> | Plus |
3R | 16435134..16435301 | 150..317 | 100 | -> | Plus |
3R | 16435356..16436066 | 318..1028 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 12260647..12260795 | 1..149 | 100 | -> | Plus |
arm_3R | 12260856..12261023 | 150..317 | 100 | -> | Plus |
arm_3R | 12261078..12261788 | 318..1028 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 16176187..16176897 | 318..1028 | 100 | Plus | |
3R | 16175756..16175904 | 1..149 | 100 | -> | Plus |
3R | 16175965..16176132 | 150..317 | 100 | -> | Plus |
Translation from 0 to 654
> RH16768.hyp TDFKSQLCLRILFMFSSHRTLKRRTPAQGIDRREYIGHLVDEYYTTTNIE AQQQVTANLANFAYDPINWSHLLEADALDVFVASLETQDQLLKVHGIAAL CNLCLDKTAAKFIREQLKLLTGLFVRTDHPEIVLHSLALFYQLLEFGERT ERDLLLSPAVLRTVQEWRVKAHDERIVKLCQLLLQDFATRTEVVQLQKAS PNVPTAEQQSSEAGASG*
Translation from 40 to 654
> RH16768.pep MFSSHRTLKRRTPAQGIDRREYIGHLVDEYYTTTNIEAQQQVTANLANFA YDPINWSHLLEADALDVFVASLETQDQLLKVHGIAALCNLCLDKTAAKFI REQLKLLTGLFVRTDHPEIVLHSLALFYQLLEFGERTERDLLLSPAVLRT VQEWRVKAHDERIVKLCQLLLQDFATRTEVVQLQKASPNVPTAEQQSSEA GASG*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF18496-PA | 304 | GF18496-PA | 1..202 | 1..203 | 768 | 70.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG17002-PA | 288 | GG17002-PA | 1..163 | 1..164 | 825 | 93.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH19343-PA | 302 | GH19343-PA | 1..204 | 1..204 | 648 | 60.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG14881-PB | 204 | CG14881-PB | 1..204 | 1..204 | 1037 | 100 | Plus |
CG14881-PA | 286 | CG14881-PA | 1..164 | 1..164 | 838 | 99.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI22553-PA | 214 | GI22553-PA | 1..203 | 1..204 | 630 | 56.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL21607-PA | 292 | GL21607-PA | 1..184 | 1..185 | 760 | 74.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA13318-PB | 208 | GA13318-PB | 1..208 | 1..204 | 789 | 69.9 | Plus |
Dpse\GA13318-PC | 288 | GA13318-PC | 1..168 | 1..169 | 687 | 74 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM15155-PA | 289 | GM15155-PA | 1..164 | 1..164 | 834 | 93.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD19099-PA | 289 | GD19099-PA | 1..164 | 1..164 | 826 | 93.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ23742-PA | 291 | GJ23742-PA | 1..164 | 1..167 | 604 | 67.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK13219-PA | 268 | GK13219-PA | 1..146 | 1..147 | 595 | 75.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE24395-PA | 288 | GE24395-PA | 1..163 | 1..164 | 811 | 92.1 | Plus |