Clone RH17222 Report

Search the DGRC for RH17222

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:172
Well:22
Vector:pFlc-1
Associated Gene/TranscriptCG15083-RA
Protein status:RH17222.pep: gold
Preliminary Size:453
Sequenced Size:687

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15083 2002-01-01 Sim4 clustering to Release 2
CG15083 2003-01-01 Sim4 clustering to Release 3
CG15083 2003-08-11 Blastp of sequenced clone
CG15083 2008-04-29 Release 5.5 accounting
CG15083 2008-08-15 Release 5.9 accounting
CG15083 2008-12-18 5.12 accounting

Clone Sequence Records

RH17222.complete Sequence

687 bp (687 high quality bases) assembled on 2003-08-11

GenBank Submission: AY071700

> RH17222.complete
GCCACTTATTATTTGATTCTTGCCCAGTGCGGTTGTGTTTCCGTGCGCTA
GGTGTTCCCAAACCGGTTTAAGTGCCATACTAGCCATATTTGTATTTGGA
AAATTCGCTGTAAACCACAGAGTTTCAAAATGAAAATCGATCTGACGGTG
GAAAATGGCCCGTGCAATACCGATTTGCGGAGCTGGTGCCTGGGAATCGC
GATCTATTGGCTATTGAGCATGACTTTCAACGTTATATTCGCTCCAAACG
TTCTTACCTTTATTGGATTTGCCATCGTAGTAGTCGCCAATATTTGCTTA
TTGATAGGAACCCTGAAGGAAAAGCCAATTCTGGTGTTCGTCTGGCTGAT
CTTCGCTGCCATTGAAGCCATCTCCTTTCCGTTTGCCGTCTTCGGGGTTA
TCTTCCACTACGGAGGATATCGCGAGGCTACCGGAATGAACAACGTTTTC
GGTGCCCTGCTCGTTTACATCATCACATTTCTATTGATCCTCTTCAGCGC
ACGAATTGTGTACTCCTTCTACCTCCAGCTGAAAAACAGCGAAGCCAGCA
AACAAACACCGCGCGCCATGAATGTGGTTTAGTCCTTATCATTCTACACT
ACATAAATTGTCGGGGAAGAGCCCACCGTTCGTTCATCTCAGTGTTTGCA
ATAAAATGCTTTGTTTTTTACAAAAAAAAAAAAAAAA

RH17222.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:31:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG15083-RA 843 CG15083-RA 113..780 3..670 3340 100 Plus
CG15083.a 701 CG15083.a 5..483 3..481 2395 100 Plus
CG15083.a 701 CG15083.a 513..701 482..670 945 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:38:14
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 14722388..14722636 2..250 1230 99.6 Plus
chr2R 21145070 chr2R 14723783..14723971 482..670 900 98.4 Plus
chr2R 21145070 chr2R 14723542..14723706 317..481 795 98.8 Plus
chr2R 21145070 chr2R 14723407..14723480 250..323 355 98.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:23:27 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:38:12
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18835265..18835512 3..250 1240 100 Plus
2R 25286936 2R 18836655..18836843 482..670 945 100 Plus
2R 25286936 2R 18836414..18836578 317..481 825 100 Plus
2R 25286936 2R 18836279..18836352 250..323 355 98.6 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:59:25
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 18836464..18836711 3..250 1240 100 Plus
2R 25260384 2R 18837854..18838042 482..670 945 100 Plus
2R 25260384 2R 18837613..18837777 317..481 825 100 Plus
2R 25260384 2R 18837478..18837551 250..323 355 98.6 Plus
Blast to na_te.dros performed on 2019-03-16 09:38:12 has no hits.

RH17222.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:39:24 Download gff for RH17222.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 14723783..14723971 482..671 97   Plus
chr2R 14723408..14723475 251..318 100 -> Plus
chr2R 14723544..14723706 319..481 98 -> Plus
chr2R 14722387..14722636 1..250 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:42:28 Download gff for RH17222.complete
Subject Subject Range Query Range Percent Splice Strand
CG15083-RA 1..453 130..582 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:50:46 Download gff for RH17222.complete
Subject Subject Range Query Range Percent Splice Strand
CG15083-RA 1..453 130..582 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:03:28 Download gff for RH17222.complete
Subject Subject Range Query Range Percent Splice Strand
CG15083-RA 1..453 130..582 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:17:17 Download gff for RH17222.complete
Subject Subject Range Query Range Percent Splice Strand
CG15083-RA 1..453 130..582 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:15:19 Download gff for RH17222.complete
Subject Subject Range Query Range Percent Splice Strand
CG15083-RA 1..453 130..582 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:14:33 Download gff for RH17222.complete
Subject Subject Range Query Range Percent Splice Strand
CG15083-RA 1..671 1..669 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:50:46 Download gff for RH17222.complete
Subject Subject Range Query Range Percent Splice Strand
CG15083-RA 1..667 3..669 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:03:28 Download gff for RH17222.complete
Subject Subject Range Query Range Percent Splice Strand
CG15083-RA 1..669 2..669 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:17:17 Download gff for RH17222.complete
Subject Subject Range Query Range Percent Splice Strand
CG15083-RA 1..671 1..669 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:15:19 Download gff for RH17222.complete
Subject Subject Range Query Range Percent Splice Strand
CG15083-RA 1..669 2..669 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:39:24 Download gff for RH17222.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18835261..18835512 1..250 99 -> Plus
2R 18836280..18836347 251..318 100 -> Plus
2R 18836416..18836578 319..481 100 -> Plus
2R 18836655..18836843 482..671 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:39:24 Download gff for RH17222.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18835261..18835512 1..250 99 -> Plus
2R 18836280..18836347 251..318 100 -> Plus
2R 18836416..18836578 319..481 100 -> Plus
2R 18836655..18836843 482..671 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:39:24 Download gff for RH17222.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18835261..18835512 1..250 99 -> Plus
2R 18836280..18836347 251..318 100 -> Plus
2R 18836416..18836578 319..481 100 -> Plus
2R 18836655..18836843 482..671 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:03:28 Download gff for RH17222.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14722766..14723017 1..250 99 -> Plus
arm_2R 14723785..14723852 251..318 100 -> Plus
arm_2R 14723921..14724083 319..481 100 -> Plus
arm_2R 14724160..14724348 482..671 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:51:19 Download gff for RH17222.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18836460..18836711 1..250 99 -> Plus
2R 18837479..18837546 251..318 100 -> Plus
2R 18837615..18837777 319..481 100 -> Plus
2R 18837854..18838042 482..671 99   Plus

RH17222.pep Sequence

Translation from 129 to 581

> RH17222.pep
MKIDLTVENGPCNTDLRSWCLGIAIYWLLSMTFNVIFAPNVLTFIGFAIV
VVANICLLIGTLKEKPILVFVWLIFAAIEAISFPFAVFGVIFHYGGYREA
TGMNNVFGALLVYIITFLLILFSARIVYSFYLQLKNSEASKQTPRAMNVV
*

RH17222.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:55:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11121-PA 148 GF11121-PA 1..148 1..150 543 68 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:55:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21931-PA 150 GG21931-PA 1..150 1..150 644 81.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 01:55:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22129-PA 147 GH22129-PA 1..142 1..142 484 62 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:27:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG15083-PA 150 CG15083-PA 1..150 1..150 769 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 01:55:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19357-PA 147 GI19357-PA 1..142 1..142 490 64.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:55:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11234-PA 147 GL11234-PA 1..147 1..150 518 65.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:55:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13477-PA 147 GA13477-PA 1..147 1..150 518 65.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:55:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21921-PA 150 GM21921-PA 1..150 1..150 727 92 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:55:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11415-PA 150 GD11415-PA 1..150 1..150 727 92 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:55:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20341-PA 148 GJ20341-PA 1..141 1..141 485 63.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 01:55:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20929-PA 147 GK20929-PA 1..147 1..150 394 54 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:55:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12004-PA 150 GE12004-PA 1..150 1..150 668 83.3 Plus

RH17222.hyp Sequence

Translation from 129 to 581

> RH17222.hyp
MKIDLTVENGPCNTDLRSWCLGIAIYWLLSMTFNVIFAPNVLTFIGFAIV
VVANICLLIGTLKEKPILVFVWLIFAAIEAISFPFAVFGVIFHYGGYREA
TGMNNVFGALLVYIITFLLILFSARIVYSFYLQLKNSEASKQTPRAMNVV
*

RH17222.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:18:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG15083-PA 150 CG15083-PA 1..150 1..150 769 100 Plus