Clone RH17228 Report

Search the DGRC for RH17228

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:172
Well:28
Vector:pFlc-1
Associated Gene/TranscriptCyt-c-p-RA
Protein status:RH17228.pep: gold
Preliminary Size:617
Sequenced Size:763

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17903 2002-01-01 Sim4 clustering to Release 2
CG17903 2003-01-01 Sim4 clustering to Release 3
CG17903 2003-08-11 Blastp of sequenced clone
Cyt-c-p 2008-04-29 Release 5.5 accounting
Cyt-c-p 2008-08-15 Release 5.9 accounting
Cyt-c-p 2008-12-18 5.12 accounting

Clone Sequence Records

RH17228.complete Sequence

763 bp (763 high quality bases) assembled on 2003-08-11

GenBank Submission: AY071701

> RH17228.complete
GAATGCGTGGCCCCCGGTCACTCTGGTCACACTAATTACCTATCGACATA
ACGCGCGCTCGTCATTCGTGAAAAATCGGCGACGCTCGACGTTTGTGTTC
AATTCGAGTCCGTGTTAACACATTAATTAACCACATAATCCATAATGGGC
GTTCCTGCTGGTGATGTTGAGAAGGGAAAGAAGCTGTTCGTGCAGCGCTG
CGCCCAGTGCCACACCGTTGAGGCTGGTGGCAAGCACAAGGTTGGACCCA
ATCTGCATGGTCTGATCGGTCGCAAGACCGGACAGGCGGCCGGATTCGCG
TACACGGACGCCAACAAGGCCAAGGGCATCACCTGGAACGAGGACACCCT
GTTCGAGTACCTGGAGAACCCCAAGAAGTACATCCCCGGCACCAAGATGA
TCTTCGCCGGTCTGAAGAAGCCCAACGAGCGCGGCGATCTGATCGCCTAC
CTGAAGTCGGCGACCAAGTAATGGTGCTGTCCATCAACTTACCCACAACC
ACTGCAGGATGTCAAACTGTATTATTGTGTTCAGTCACAGTCCGGCACGC
AAATGCAGCAGCAGCAACAACTACAACTACAAATCAACATAGTACAGACC
TAAAGAACTACAATTATGTTAATTATAAAGTTTAAATAGGACAATTTATT
ATTTAATTTAAATAAAAAGTGGAATATTTAATTCAAACCCGATGAGAATT
GTGACATCCACAAAAAAGTTAAATAATAAAAAAAGAACTAAAAAACGAAA
AAAAAAAAAAAAA

RH17228.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:31:10
Subject Length Description Subject Range Query Range Score Percent Strand
Cyt-c-p-RA 823 Cyt-c-p-RA 2..755 2..755 3725 99.6 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:31:25
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 16720741..16721382 104..745 3195 99.8 Plus
chr2L 23010047 chr2L 16718607..16718708 2..103 510 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:23:28 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:31:22
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 16722009..16722660 104..755 3215 99.5 Plus
2L 23513712 2L 16719875..16719976 2..103 510 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:59:28
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 16722009..16722660 104..755 3215 99.5 Plus
2L 23513712 2L 16719875..16719976 2..103 510 100 Plus
Blast to na_te.dros performed 2019-03-15 20:31:23
Subject Length Description Subject Range Query Range Score Percent Strand
rover 7318 rover ROVER 7318bp 678..846 566..743 147 58.7 Plus
rover 7318 rover ROVER 7318bp 829..997 566..743 147 58.7 Plus
rover 7318 rover ROVER 7318bp 980..1079 566..667 135 63.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2627..2665 549..589 128 82.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 5649..5751 550..652 127 63.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1557..1674 556..672 119 59.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6721..6768 542..589 113 75.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2402..2434 549..581 111 81.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2499..2546 556..602 111 72.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6748..6789 549..589 108 76.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6769..6810 549..589 108 76.2 Plus

RH17228.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:32:26 Download gff for RH17228.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 16718606..16718708 1..103 99 -> Plus
chr2L 16720741..16721357 104..720 95   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:50:54 Download gff for RH17228.complete
Subject Subject Range Query Range Percent Splice Strand
Cyt-c-p-RA 1..327 145..471 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:14:51 Download gff for RH17228.complete
Subject Subject Range Query Range Percent Splice Strand
Cyt-c-p-RA 1..327 145..471 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:17:20 Download gff for RH17228.complete
Subject Subject Range Query Range Percent Splice Strand
Cyt-c-p-RA 1..327 145..471 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:23:19 Download gff for RH17228.complete
Subject Subject Range Query Range Percent Splice Strand
Cyt-c-p-RA 1..327 145..471 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:14:38 Download gff for RH17228.complete
Subject Subject Range Query Range Percent Splice Strand
Cyt-c-p-RA 2..720 2..720 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:50:54 Download gff for RH17228.complete
Subject Subject Range Query Range Percent Splice Strand
Cyt-c-p-RA 2..720 2..720 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:14:51 Download gff for RH17228.complete
Subject Subject Range Query Range Percent Splice Strand
Cyt-c-p-RA 1..662 59..720 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:17:20 Download gff for RH17228.complete
Subject Subject Range Query Range Percent Splice Strand
Cyt-c-p-RA 2..720 2..720 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:23:19 Download gff for RH17228.complete
Subject Subject Range Query Range Percent Splice Strand
Cyt-c-p-RA 1..662 59..720 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:32:26 Download gff for RH17228.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16719874..16719976 1..103 99 -> Plus
2L 16722009..16722625 104..720 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:32:26 Download gff for RH17228.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16719874..16719976 1..103 99 -> Plus
2L 16722009..16722625 104..720 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:32:26 Download gff for RH17228.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16719874..16719976 1..103 99 -> Plus
2L 16722009..16722625 104..720 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:14:51 Download gff for RH17228.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 16719874..16719976 1..103 99 -> Plus
arm_2L 16722009..16722625 104..720 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:51:23 Download gff for RH17228.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16722009..16722625 104..720 100   Plus
2L 16719874..16719976 1..103 99 -> Plus

RH17228.hyp Sequence

Translation from 144 to 470

> RH17228.hyp
MGVPAGDVEKGKKLFVQRCAQCHTVEAGGKHKVGPNLHGLIGRKTGQAAG
FAYTDANKAKGITWNEDTLFEYLENPKKYIPGTKMIFAGLKKPNERGDLI
AYLKSATK*

RH17228.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:24:43
Subject Length Description Subject Range Query Range Score Percent Strand
Cyt-c-p-PB 108 CG17903-PB 1..108 1..108 578 100 Plus
Cyt-c-p-PA 108 CG17903-PA 1..108 1..108 578 100 Plus
Cyt-c-d-PB 105 CG13263-PB 3..103 5..105 407 72.3 Plus
Cyt-c-d-PA 105 CG13263-PA 3..103 5..105 407 72.3 Plus

RH17228.pep Sequence

Translation from 144 to 470

> RH17228.pep
MGVPAGDVEKGKKLFVQRCAQCHTVEAGGKHKVGPNLHGLIGRKTGQAAG
FAYTDANKAKGITWNEDTLFEYLENPKKYIPGTKMIFAGLKKPNERGDLI
AYLKSATK*

RH17228.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:57:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20853-PA 108 GF20853-PA 1..108 1..108 569 100 Plus
Dana\GF20842-PA 104 GF20842-PA 4..101 7..104 383 71.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:57:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22763-PA 108 GG22763-PA 1..108 1..108 569 100 Plus
Dere\GG22762-PA 105 GG22762-PA 3..103 5..105 387 71.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 01:57:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11376-PA 108 GH11376-PA 1..108 1..108 563 99.1 Plus
Dgri\GH11375-PA 103 GH11375-PA 4..101 7..105 341 63.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:18:58
Subject Length Description Subject Range Query Range Score Percent Strand
Cyt-c-p-PB 108 CG17903-PB 1..108 1..108 578 100 Plus
Cyt-c-p-PA 108 CG17903-PA 1..108 1..108 578 100 Plus
Cyt-c-d-PB 105 CG13263-PB 3..103 5..105 407 72.3 Plus
Cyt-c-d-PA 105 CG13263-PA 3..103 5..105 407 72.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 01:57:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18081-PA 108 GI18081-PA 1..108 1..108 560 98.1 Plus
Dmoj\GI18080-PA 104 GI18080-PA 4..102 7..105 353 64.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:57:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18778-PA 116 GL18778-PA 1..98 1..98 515 98 Plus
Dper\GL18777-PA 105 GL18777-PA 4..102 6..104 406 71.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:57:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14714-PA 108 GA14714-PA 1..108 1..108 569 100 Plus
Dpse\GA12159-PA 105 GA12159-PA 4..102 6..104 406 71.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:57:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17197-PA 108 GM17197-PA 1..108 1..108 569 100 Plus
Dsec\GM17196-PA 105 GM17196-PA 3..103 5..105 396 72.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:57:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24074-PA 108 GD24074-PA 1..108 1..108 569 100 Plus
Dsim\GD24072-PA 105 GD24072-PA 3..103 5..105 396 72.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:57:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16722-PA 108 GJ16722-PA 1..108 1..108 563 99.1 Plus
Dvir\GJ16711-PA 104 GJ16711-PA 4..102 7..105 379 70.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 01:57:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15007-PA 108 GK15007-PA 1..108 1..108 563 98.1 Plus
Dwil\GK18205-PA 105 GK18205-PA 3..102 5..104 396 70 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:57:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12757-PA 108 GE12757-PA 1..108 1..108 569 100 Plus
Dyak\GE12756-PA 105 GE12756-PA 3..103 5..105 396 72.3 Plus