Clone RH17287 Report

Search the DGRC for RH17287

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:172
Well:87
Vector:pFlc-1
Associated Gene/TranscriptCG9360-RA
Protein status:RH17287.pep: gold
Preliminary Size:756
Sequenced Size:1050

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9360 2002-01-01 Sim4 clustering to Release 2
CG9360 2002-03-28 Blastp of sequenced clone
CG9360 2003-01-01 Sim4 clustering to Release 3
CG9360 2008-04-29 Release 5.5 accounting
CG9360 2008-08-15 Release 5.9 accounting
CG9360 2008-12-18 5.12 accounting

Clone Sequence Records

RH17287.complete Sequence

1050 bp (1050 high quality bases) assembled on 2002-03-28

GenBank Submission: AY094912

> RH17287.complete
GGCAGTTCTAGAACAGGTCGCGATCGCAAACCAACCGTATATACATATAT
ATATATATATACATCTCAGTTGCATTAGACCCGTACAAACAAATACTAAA
TACAAATTATGGATCGTTGGCTAAATCGCGTTGCTGTTGTCACTGGCGCC
AGTTCGGGAATCGGAGCTGCCTGTTGCAAGGATTTGGTGTCCAAGGGCTT
GGTGGTCGTGGGTCTTGCACGTCGCGAGGACCGTCTGCAGGAGCTGAAGG
CTTCGCTGCCAGCGGACCAGGCCAGTCGTTTCCATGGACGCAAATGCGAT
GTGAGCCAGGAGCAGGAGGTGATCGATGCGTTCGCATGGATCGATGCAAC
ACTGGGCGGTGCCGATGTGCTGGTCAACAACGCTGGCATTGTTCGCCTCG
GTGTGGGCATCACCCACGAGGGTAATGGCGCTGATCTTCGTGCCATTCTG
GATACCAATGTCCTGGGCGTTTCGTGGTGCACCCGCGAGGCTTTCAAATC
ACTGAAGAGACGCAATGTTAACGATGGACACATCCTGATTGTCAACAGTG
TGGCCGGACACCGGGTGATCAACAACCCAGGCATCACCATGGGCATGTAT
TCGCCATCGAAGTACGCAGTCACCGCTCTCACGGAGGTGCTGCGTCAGGA
GTTCCACAACAACAAGACCCAGACCAAGATTACGAGCATCAGTCCCGGTG
CCGTGGACACCGAGATCATCGACAAGGAGGCTCTCGTTGGCATTCCCGAC
TTTCCAATGCTCCGCTCTGAGGATGTGGCCGATGCCATTAGCTACTGCAT
CCAGACCCCGCCAAATGTCCAGATTCACGAGCTGACCATCAAGCCTGTCG
GCGAAACCCTCTAGACTCTAGATTTCCCACTGGATGCTTCTGCTATTTGT
GTTTACAACAAGGAAGTGTCATATGAAGTTGATCTACTATATTTTATTTT
TATTAAAAATATATATATATCTATATATATATATGTATGTATGCATGTAC
CAAACGTTATGTGATTAAAATTCTTTAGCAAACCAAAAAAAAAAAAAAAA

RH17287.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:18:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG9360-RA 1049 CG9360-RA 14..1048 2..1036 5175 100 Plus
CG3301-RB 1140 CG3301-RB 93..181 124..212 190 80.8 Plus
CG3301-RA 1227 CG3301-RA 225..313 124..212 190 80.8 Plus
CG3301-RB 1140 CG3301-RB 723..811 757..845 175 79.7 Plus
CG3301-RA 1227 CG3301-RA 855..943 757..845 175 79.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:03:46
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 11655102..11655784 684..2 3385 99.7 Minus
chrX 22417052 chrX 11654670..11655020 1034..684 1725 99.4 Minus
chr3R 27901430 chr3R 17099765..17100024 383..124 280 73.8 Minus
chrX 22417052 chrX 8865867..8865932 174..109 210 87.9 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:23:30 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:03:44
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 11763906..11764588 684..2 3415 100 Minus
X 23542271 X 11763472..11763824 1036..684 1765 100 Minus
3R 32079331 3R 21275937..21276196 383..124 265 73.5 Minus
X 23542271 X 8974162..8974227 174..109 210 87.9 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:48:16
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 11772004..11772686 684..2 3415 100 Minus
X 23527363 X 11771570..11771922 1036..684 1765 100 Minus
X 23527363 X 8982260..8982325 174..109 210 87.8 Minus
3R 31820162 3R 21016939..21017027 212..124 190 80.8 Minus
3R 31820162 3R 21016251..21016339 845..757 175 79.7 Minus
Blast to na_te.dros performed on 2019-03-16 13:03:44 has no hits.

RH17287.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:04:30 Download gff for RH17287.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 11654767..11655019 685..937 100 <- Minus
chrX 11655102..11655784 1..684 95   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:42:30 Download gff for RH17287.complete
Subject Subject Range Query Range Percent Splice Strand
CG9360-RA 1..756 109..864 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:22:53 Download gff for RH17287.complete
Subject Subject Range Query Range Percent Splice Strand
CG9360-RA 1..756 109..864 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:14:49 Download gff for RH17287.complete
Subject Subject Range Query Range Percent Splice Strand
CG9360-RA 1..756 109..864 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:59:25 Download gff for RH17287.complete
Subject Subject Range Query Range Percent Splice Strand
CG9360-RA 1..756 109..864 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:12:39 Download gff for RH17287.complete
Subject Subject Range Query Range Percent Splice Strand
CG9360-RA 1..756 109..864 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:49:50 Download gff for RH17287.complete
Subject Subject Range Query Range Percent Splice Strand
CG9360-RA 1..1033 2..1034 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:22:53 Download gff for RH17287.complete
Subject Subject Range Query Range Percent Splice Strand
CG9360-RA 1..1033 2..1034 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:14:49 Download gff for RH17287.complete
Subject Subject Range Query Range Percent Splice Strand
CG9360-RA 1..1035 1..1034 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:59:25 Download gff for RH17287.complete
Subject Subject Range Query Range Percent Splice Strand
CG9360-RA 1..1033 2..1034 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:12:39 Download gff for RH17287.complete
Subject Subject Range Query Range Percent Splice Strand
CG9360-RA 1..1035 1..1034 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:04:30 Download gff for RH17287.complete
Subject Subject Range Query Range Percent Splice Strand
X 11763474..11763823 685..1034 100 <- Minus
X 11763906..11764588 1..684 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:04:30 Download gff for RH17287.complete
Subject Subject Range Query Range Percent Splice Strand
X 11763474..11763823 685..1034 100 <- Minus
X 11763906..11764588 1..684 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:04:30 Download gff for RH17287.complete
Subject Subject Range Query Range Percent Splice Strand
X 11763474..11763823 685..1034 100 <- Minus
X 11763906..11764588 1..684 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:14:49 Download gff for RH17287.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 11657507..11657856 685..1034 100 <- Minus
arm_X 11657939..11658621 1..684 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:32:16 Download gff for RH17287.complete
Subject Subject Range Query Range Percent Splice Strand
X 11771572..11771921 685..1034 100 <- Minus
X 11772004..11772686 1..684 99   Minus

RH17287.hyp Sequence

Translation from 108 to 863

> RH17287.hyp
MDRWLNRVAVVTGASSGIGAACCKDLVSKGLVVVGLARREDRLQELKASL
PADQASRFHGRKCDVSQEQEVIDAFAWIDATLGGADVLVNNAGIVRLGVG
ITHEGNGADLRAILDTNVLGVSWCTREAFKSLKRRNVNDGHILIVNSVAG
HRVINNPGITMGMYSPSKYAVTALTEVLRQEFHNNKTQTKITSISPGAVD
TEIIDKEALVGIPDFPMLRSEDVADAISYCIQTPPNVQIHELTIKPVGET
L*

RH17287.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:18:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG9360-PA 251 CG9360-PA 1..251 1..251 1286 100 Plus
CG3301-PC 250 CG3301-PC 1..248 1..249 888 69.5 Plus
CG3301-PB 250 CG3301-PB 1..248 1..249 888 69.5 Plus
CG3301-PA 250 CG3301-PA 1..248 1..249 888 69.5 Plus
CG9150-PB 251 CG9150-PB 1..249 1..249 645 49.8 Plus

RH17287.pep Sequence

Translation from 108 to 863

> RH17287.pep
MDRWLNRVAVVTGASSGIGAACCKDLVSKGLVVVGLARREDRLQELKASL
PADQASRFHGRKCDVSQEQEVIDAFAWIDATLGGADVLVNNAGIVRLGVG
ITHEGNGADLRAILDTNVLGVSWCTREAFKSLKRRNVNDGHILIVNSVAG
HRVINNPGITMGMYSPSKYAVTALTEVLRQEFHNNKTQTKITSISPGAVD
TEIIDKEALVGIPDFPMLRSEDVADAISYCIQTPPNVQIHELTIKPVGET
L*

RH17287.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:05:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20253-PA 252 GF20253-PA 1..252 1..251 1045 77.4 Plus
Dana\GF16365-PA 250 GF16365-PA 1..248 1..249 1001 73.5 Plus
Dana\GF17260-PA 250 GF17260-PA 1..250 1..251 995 73.3 Plus
Dana\GF16364-PA 250 GF16364-PA 1..250 1..251 978 70.9 Plus
Dana\GF15405-PA 251 GF15405-PA 1..251 1..251 691 52.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:05:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18834-PA 251 GG18834-PA 1..251 1..251 1148 90 Plus
Dere\GG14727-PA 250 GG14727-PA 1..248 1..249 927 69.9 Plus
Dere\GG10137-PA 251 GG10137-PA 1..251 1..251 668 50.2 Plus
Dere\GG13756-PA 252 GG13756-PA 1..252 1..251 651 48.2 Plus
Dere\GG18873-PA 250 GG18873-PA 1..250 1..251 628 50 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:05:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18905-PA 250 GH18905-PA 1..250 1..251 1001 74.1 Plus
Dgri\GH24588-PA 250 GH24588-PA 1..248 1..249 979 75.1 Plus
Dgri\GH18894-PA 249 GH18894-PA 1..249 1..251 976 72.5 Plus
Dgri\GH10934-PA 251 GH10934-PA 1..251 1..251 664 49.8 Plus
Dgri\GH17647-PA 254 GH17647-PA 1..254 1..251 641 48.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:56:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG9360-PA 251 CG9360-PA 1..251 1..251 1286 100 Plus
CG3301-PC 250 CG3301-PC 1..248 1..249 888 69.5 Plus
CG3301-PB 250 CG3301-PB 1..248 1..249 888 69.5 Plus
CG3301-PA 250 CG3301-PA 1..248 1..249 888 69.5 Plus
CG9150-PB 251 CG9150-PB 1..249 1..249 645 49.8 Plus
CG8757-PB 252 CG8757-PB 1..250 1..249 635 49 Plus
antdh-PA 250 CG1386-PA 1..250 1..251 605 50 Plus
CG40486-PC 247 CG40486-PC 1..245 1..249 598 49.6 Plus
CG40486-PB 247 CG40486-PB 1..245 1..249 598 49.6 Plus
CG10962-PB 249 CG10962-PB 1..247 1..249 581 50.4 Plus
CG40485-PC 247 CG40485-PC 1..245 1..249 579 48.4 Plus
CG40485-PB 247 CG40485-PB 1..245 1..249 579 48.4 Plus
rdhB-PB 248 CG7077-PB 7..242 4..245 431 38 Plus
rdhB-PA 248 CG7077-PA 7..242 4..245 431 38 Plus
CG40485-PA 231 CG40485-PA 1..192 1..192 414 45.6 Plus
CG31549-PB 257 CG31549-PB 1..192 1..203 177 31 Plus
CG31549-PA 257 CG31549-PA 1..192 1..203 177 31 Plus
CG3699-PA 251 CG3699-PA 5..186 6..203 176 33.3 Plus
CG10672-PA 317 CG10672-PA 66..295 1..231 174 27.5 Plus
CG12171-PA 257 CG12171-PA 1..204 1..210 164 30.2 Plus
CG7601-PA 326 CG7601-PA 54..243 7..203 160 29.4 Plus
CG18814-PB 267 CG18814-PB 9..190 10..204 150 27.6 Plus
CG30491-PB 331 CG30491-PB 46..244 7..204 148 26.1 Plus
CG30491-PA 331 CG30491-PA 46..244 7..204 148 26.1 Plus
CG7322-PC 242 CG7322-PC 8..184 7..203 146 31 Plus
CG7322-PB 242 CG7322-PB 8..184 7..203 146 31 Plus
CG7322-PA 242 CG7322-PA 8..184 7..203 146 31 Plus
CG4842-PA 259 CG4842-PA 9..233 10..236 146 25.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:05:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15259-PA 251 GI15259-PA 1..251 1..251 970 71.7 Plus
Dmoj\GI10833-PA 250 GI10833-PA 1..250 1..251 947 69.7 Plus
Dmoj\GI14955-PA 247 GI14955-PA 1..247 1..251 664 51.2 Plus
Dmoj\GI13477-PA 251 GI13477-PA 1..251 1..251 648 48.6 Plus
Dmoj\GI14956-PA 247 GI14956-PA 1..245 1..249 640 49.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:05:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24037-PA 250 GL24037-PA 1..250 1..251 1046 76.5 Plus
Dper\GL15228-PA 245 GL15228-PA 1..245 1..251 1000 73.7 Plus
Dper\GL27161-PA 250 GL27161-PA 1..248 1..249 987 75.5 Plus
Dper\GL24038-PA 240 GL24038-PA 1..240 1..248 969 73.1 Plus
Dper\GL24036-PA 249 GL24036-PA 1..249 1..251 932 71.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:05:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21729-PA 250 GA21729-PA 1..250 1..251 1043 75.7 Plus
Dpse\GA10693-PA 250 GA10693-PA 1..250 1..251 1040 76.5 Plus
Dpse\GA26486-PA 250 GA26486-PA 1..250 1..251 1031 75.7 Plus
Dpse\GA17238-PA 250 GA17238-PA 1..248 1..249 981 75.1 Plus
Dpse\GA21577-PA 251 GA21577-PA 1..251 1..251 661 48.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:05:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13047-PA 251 GM13047-PA 1..251 1..251 1285 95.6 Plus
Dsec\GM10850-PA 250 GM10850-PA 1..250 1..251 992 75.7 Plus
Dsec\GM15086-PA 250 GM15086-PA 1..248 1..249 912 69.1 Plus
Dsec\GM24579-PA 252 GM24579-PA 1..252 1..251 659 49.4 Plus
Dsec\GM17962-PA 251 GM17962-PA 1..251 1..251 657 49.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:05:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15972-PA 251 GD15972-PA 1..251 1..251 1285 96 Plus
Dsim\GD19832-PA 250 GD19832-PA 1..250 1..251 1020 74.9 Plus
Dsim\GD19991-PA 250 GD19991-PA 1..250 1..251 926 68.9 Plus
Dsim\GD22600-PA 251 GD22600-PA 1..251 1..251 660 49.4 Plus
Dsim\GD15999-PA 250 GD15999-PA 1..250 1..251 615 49.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:05:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14832-PA 250 GJ14832-PA 1..250 1..251 1041 79.3 Plus
Dvir\GJ23779-PA 249 GJ23779-PA 1..249 1..251 1026 77.7 Plus
Dvir\GJ14831-PA 250 GJ14831-PA 1..250 1..251 988 73.7 Plus
Dvir\GJ14440-PA 250 GJ14440-PA 1..250 1..251 959 71.7 Plus
Dvir\GJ12118-PA 251 GJ12118-PA 1..251 1..251 666 50.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:05:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14222-PA 307 GK14222-PA 1..250 1..251 1032 74.9 Plus
Dwil\GK14223-PA 250 GK14223-PA 1..250 1..251 1017 74.1 Plus
Dwil\GK14224-PA 250 GK14224-PA 1..250 1..251 972 72.9 Plus
Dwil\GK14225-PA 250 GK14225-PA 1..250 1..251 968 70.9 Plus
Dwil\GK16284-PA 278 GK16284-PA 1..250 1..251 963 72.5 Plus
Dwil\GK14222-PA 307 GK14222-PA 249..307 193..251 229 71.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:05:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17599-PA 251 GE17599-PA 1..251 1..251 1181 87.6 Plus
Dyak\GE25000-PA 250 GE25000-PA 1..250 1..251 912 68.1 Plus
Dyak\GE18948-PA 251 GE18948-PA 1..251 1..251 660 49 Plus
Dyak\GE20052-PA 266 GE20052-PA 15..266 1..251 653 48.6 Plus
Dyak\GE17313-PA 250 GE17313-PA 1..250 1..251 624 50 Plus