Clone RH17411 Report

Search the DGRC for RH17411

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:174
Well:11
Vector:pFlc-1
Associated Gene/TranscriptCG12384-RA
Protein status:RH17411.pep: gold
Preliminary Size:591
Sequenced Size:597

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12384 2002-10-18 Blastp of sequenced clone
CG12384 2003-01-01 Sim4 clustering to Release 3
CG12384 2008-04-29 Release 5.5 accounting
CG12384 2008-08-15 Release 5.9 accounting
CG12384 2008-12-18 5.12 accounting

Clone Sequence Records

RH17411.complete Sequence

597 bp (597 high quality bases) assembled on 2002-10-18

GenBank Submission: BT001778

> RH17411.complete
GACAATTAGAACGCAAAAGCAAAACACAGCGGTGCCGCGCATTTATTTAC
AACTAGAAAAGCGCTTACTAAACCAGAACAAATGGCAGATGAACAACCAA
ATCTTGTGGCCGGACACCCACCTGCATTGAAGGCTGGTGGCATGCGAATT
GTGCAGCACAAAGCGCCGACGGCAGAACGCGCGCCCAAGGATGCAGAGGA
TTGTACTGGACTGACACAACCCATTGCCGTGAACTCCGGCTCTGTGAGCG
GTGCCCCCGTCAAGGGCAACACGGACTTTACGCCCGCCTCCGCCCAGGTG
GCCCACTCGCCCAAGCCACCGGCTGCAGTGCAGCAGAAGCCCCAGATCCA
CATCCAGCAGCCACGGAAGTGATGCGTACTCGGGCGGAATAACTATTATC
ATTATCTAATCTCTTTGATCTTTTGTTGAAATTCTATGAGTCCTCTCAAT
GGTATTGAAATCGCCTTTGAATGCGATATTTACTCTTTAATTTTATATAT
GCATTTGCCACTGCATTCCATAAATTAAAAATGCTGATTTTCTGAGTTAA
TATTTTGTAATAAACTTTATCCCTTTTATAGAAAAAAAAAAAAAAAA

RH17411.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:45:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG12384-RA 848 CG12384-RA 169..749 2..582 2905 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:42:08
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 7245357..7245721 581..217 1825 100 Minus
chr2R 21145070 chr2R 7245786..7245874 216..128 445 100 Minus
chr2R 21145070 chr2R 7246408..7246472 127..63 325 100 Minus
chr2R 21145070 chr2R 7246538..7246599 63..2 310 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:23:33 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:42:06
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11357906..11358271 582..217 1830 100 Minus
2R 25286936 2R 11358336..11358424 216..128 445 100 Minus
2R 25286936 2R 11358958..11359022 127..63 325 100 Minus
2R 25286936 2R 11359088..11359149 63..2 310 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:05:38
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 11359105..11359470 582..217 1830 100 Minus
2R 25260384 2R 11359535..11359623 216..128 445 100 Minus
2R 25260384 2R 11360157..11360221 127..63 325 100 Minus
2R 25260384 2R 11360287..11360348 63..2 310 100 Minus
Blast to na_te.dros performed 2019-03-15 16:42:06
Subject Length Description Subject Range Query Range Score Percent Strand
mdg3 5519 mdg3 DMMDG3 5519bp Derived from X95908 (e990667) (Rel. 49, Last updated, Version 3). 2061..2141 497..419 121 63 Minus

RH17411.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:42:53 Download gff for RH17411.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 7245357..7245721 217..581 100 <- Minus
chr2R 7245786..7245874 128..216 100 <- Minus
chr2R 7246408..7246471 64..127 100 <- Minus
chr2R 7246538..7246599 1..63 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:42:32 Download gff for RH17411.complete
Subject Subject Range Query Range Percent Splice Strand
CG12384-RA 1..291 82..372 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:39:05 Download gff for RH17411.complete
Subject Subject Range Query Range Percent Splice Strand
CG12384-RA 1..291 82..372 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:08:17 Download gff for RH17411.complete
Subject Subject Range Query Range Percent Splice Strand
CG12384-RA 1..291 82..372 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:16:04 Download gff for RH17411.complete
Subject Subject Range Query Range Percent Splice Strand
CG12384-RA 1..291 82..372 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:46:54 Download gff for RH17411.complete
Subject Subject Range Query Range Percent Splice Strand
CG12384-RA 1..291 82..372 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:43:47 Download gff for RH17411.complete
Subject Subject Range Query Range Percent Splice Strand
CG12384-RA 4..584 1..581 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:39:05 Download gff for RH17411.complete
Subject Subject Range Query Range Percent Splice Strand
CG12384-RA 20..600 1..581 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:08:17 Download gff for RH17411.complete
Subject Subject Range Query Range Percent Splice Strand
CG12384-RA 27..607 1..581 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:16:04 Download gff for RH17411.complete
Subject Subject Range Query Range Percent Splice Strand
CG12384-RA 4..584 1..581 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:46:54 Download gff for RH17411.complete
Subject Subject Range Query Range Percent Splice Strand
CG12384-RA 27..607 1..581 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:42:53 Download gff for RH17411.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11357907..11358271 217..581 100 <- Minus
2R 11358336..11358424 128..216 100 <- Minus
2R 11358958..11359021 64..127 100 <- Minus
2R 11359088..11359149 1..63 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:42:53 Download gff for RH17411.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11357907..11358271 217..581 100 <- Minus
2R 11358336..11358424 128..216 100 <- Minus
2R 11358958..11359021 64..127 100 <- Minus
2R 11359088..11359149 1..63 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:42:53 Download gff for RH17411.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11357907..11358271 217..581 100 <- Minus
2R 11358336..11358424 128..216 100 <- Minus
2R 11358958..11359021 64..127 100 <- Minus
2R 11359088..11359149 1..63 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:08:17 Download gff for RH17411.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7246463..7246526 64..127 100 <- Minus
arm_2R 7246593..7246654 1..63 98   Minus
arm_2R 7245412..7245776 217..581 100 <- Minus
arm_2R 7245841..7245929 128..216 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:51:54 Download gff for RH17411.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11360287..11360348 1..63 98   Minus
2R 11359106..11359470 217..581 100 <- Minus
2R 11359535..11359623 128..216 100 <- Minus
2R 11360157..11360220 64..127 100 <- Minus

RH17411.pep Sequence

Translation from 81 to 371

> RH17411.pep
MADEQPNLVAGHPPALKAGGMRIVQHKAPTAERAPKDAEDCTGLTQPIAV
NSGSVSGAPVKGNTDFTPASAQVAHSPKPPAAVQQKPQIHIQQPRK*

RH17411.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 21:58:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12400-PA 96 GF12400-PA 1..96 1..96 442 90.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 21:58:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22656-PA 96 GG22656-PA 1..96 1..96 488 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 21:58:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22862-PA 97 GH22862-PA 1..97 1..96 428 89.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:44:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG12384-PA 96 CG12384-PA 1..96 1..96 503 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 21:58:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21241-PA 96 GI21241-PA 1..96 1..96 436 89.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 21:59:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17336-PA 96 GL17336-PA 1..96 1..96 416 84.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 21:59:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11596-PA 96 GA11596-PA 1..96 1..96 416 84.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 21:59:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20437-PA 96 GM20437-PA 1..96 1..96 488 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 21:59:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15253-PA 96 GD15253-PA 1..96 1..96 488 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 21:59:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20845-PA 96 GJ20845-PA 1..96 1..96 421 87.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 21:59:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19452-PA 96 GK19452-PA 1..96 1..96 427 88.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 21:59:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13531-PA 96 GE13531-PA 1..96 1..96 483 99 Plus

RH17411.hyp Sequence

Translation from 81 to 371

> RH17411.hyp
MADEQPNLVAGHPPALKAGGMRIVQHKAPTAERAPKDAEDCTGLTQPIAV
NSGSVSGAPVKGNTDFTPASAQVAHSPKPPAAVQQKPQIHIQQPRK*

RH17411.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:11:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG12384-PA 96 CG12384-PA 1..96 1..96 503 100 Plus