BDGP Sequence Production Resources |
Search the DGRC for RH17470
Library: | RH |
Tissue Source: | Drosophila melanogaster adult head |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2001-04-30 |
Comments: | Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 174 |
Well: | 70 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG17244-RA |
Protein status: | RH17470.pep: gold |
Preliminary Size: | 480 |
Sequenced Size: | 647 |
Gene | Date | Evidence |
---|---|---|
CG17244 | 2002-01-01 | Sim4 clustering to Release 2 |
CG17244 | 2002-04-22 | Blastp of sequenced clone |
CG17244 | 2003-01-01 | Sim4 clustering to Release 3 |
CG17244 | 2008-04-29 | Release 5.5 accounting |
CG17244 | 2008-08-15 | Release 5.9 accounting |
CG17244 | 2008-12-18 | 5.12 accounting |
647 bp (647 high quality bases) assembled on 2002-04-22
GenBank Submission: AY113571
> RH17470.complete GAGTCGAACGTCTATCGCAGTGCCAACAAGTCGGCGATGAAGCGGTTTCT TGTGGCCTTATTGGCCGCTCTGCTGGTAGCCGCCGTCCAGGGCGGAATTC TGGGCAGAATTTTCCACAGGGAGTCCACCTCCACAACAACCAGCACAACT ACGACGACCACAGAGGAGCCCCGCCGACCCTTCTACATCAACAACAATAT TCCCGAAATCCCGAAGGACTGTGTGGCGCAGTTCAAGTGCAAAAAGAAGC TGGCGAATGTTCAGGCTCCAAAACCGTGTGTGAAATACTGCCTGCACAGG ATCACCTGTCCCAATAACCAGACCAGTCCCGTTCAGCCCAACCAGTGTGT CGATCTCGACGAGCAACAGGTGCTGGCCGTCCACGAGGCAAACACGGAGC CTCCGGTCGCCGGCCAAACCACCACCGAGAAGACCATGATGGTGGCCATG ATCGACTTCCCCTGCCAGCCCGGCTATCTGCCCGACCATCGTGGTCGCTG TCGGGAAATCTGGTGATTCGATGGCTTCGTGACACGTGTTTACTGCATAA TTATACCTGTGGAATTTTCGTTTTTATATACATGCCTGCTCCCAATAATC ACAATAAAACCCAAACGAACGGCTTTTGCCCAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 18800689..18801318 | 2..631 | 3075 | 99.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 22977273..22977905 | 2..634 | 3165 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 22718104..22718736 | 2..634 | 3165 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 18800687..18801318 | 1..631 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17244-RA | 1..480 | 37..516 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17244-RA | 1..480 | 37..516 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17244-RA | 1..480 | 37..516 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17244-RA | 1..480 | 37..516 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17244-RA | 1..480 | 37..516 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17244-RA | 1..621 | 1..620 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17244-RA | 1..621 | 1..620 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17244-RA | 2..633 | 1..631 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17244-RA | 1..621 | 1..620 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17244-RA | 2..633 | 1..631 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 22977271..22977902 | 1..631 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 22977271..22977902 | 1..631 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 22977271..22977902 | 1..631 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 18802993..18803624 | 1..631 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 22718102..22718733 | 1..631 | 99 | Plus |
Translation from 36 to 515
> RH17470.pep MKRFLVALLAALLVAAVQGGILGRIFHRESTSTTTSTTTTTTEEPRRPFY INNNIPEIPKDCVAQFKCKKKLANVQAPKPCVKYCLHRITCPNNQTSPVQ PNQCVDLDEQQVLAVHEANTEPPVAGQTTTEKTMMVAMIDFPCQPGYLPD HRGRCREIW*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF16717-PA | 155 | GF16717-PA | 1..155 | 1..159 | 583 | 72.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG11173-PA | 156 | GG11173-PA | 1..156 | 1..159 | 518 | 75.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH22356-PA | 160 | GH22356-PA | 12..160 | 10..159 | 460 | 60.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Gbp3-PB | 159 | CG17244-PB | 1..159 | 1..159 | 856 | 100 | Plus |
Gbp3-PA | 159 | CG17244-PA | 1..159 | 1..159 | 856 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI21999-PA | 157 | GI21999-PA | 1..157 | 1..159 | 419 | 56.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM26475-PA | 156 | GM26475-PA | 1..156 | 1..159 | 654 | 89.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD20991-PA | 156 | GD20991-PA | 1..156 | 1..159 | 618 | 88.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ14354-PA | 158 | GJ14354-PA | 6..158 | 4..159 | 448 | 58 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK11480-PA | 159 | GK11480-PA | 4..159 | 2..159 | 462 | 55.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE10341-PA | 163 | GE10341-PA | 1..163 | 1..159 | 542 | 76.7 | Plus |
Translation from 36 to 515
> RH17470.hyp MKRFLVALLAALLVAAVQGGILGRIFHRESTSTTTSTTTTTTEEPRRPFY INNNIPEIPKDCVAQFKCKKKLANVQAPKPCVKYCLHRITCPNNQTSPVQ PNQCVDLDEQQVLAVHEANTEPPVAGQTTTEKTMMVAMIDFPCQPGYLPD HRGRCREIW*