Clone RH17470 Report

Search the DGRC for RH17470

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:174
Well:70
Vector:pFlc-1
Associated Gene/TranscriptCG17244-RA
Protein status:RH17470.pep: gold
Preliminary Size:480
Sequenced Size:647

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17244 2002-01-01 Sim4 clustering to Release 2
CG17244 2002-04-22 Blastp of sequenced clone
CG17244 2003-01-01 Sim4 clustering to Release 3
CG17244 2008-04-29 Release 5.5 accounting
CG17244 2008-08-15 Release 5.9 accounting
CG17244 2008-12-18 5.12 accounting

Clone Sequence Records

RH17470.complete Sequence

647 bp (647 high quality bases) assembled on 2002-04-22

GenBank Submission: AY113571

> RH17470.complete
GAGTCGAACGTCTATCGCAGTGCCAACAAGTCGGCGATGAAGCGGTTTCT
TGTGGCCTTATTGGCCGCTCTGCTGGTAGCCGCCGTCCAGGGCGGAATTC
TGGGCAGAATTTTCCACAGGGAGTCCACCTCCACAACAACCAGCACAACT
ACGACGACCACAGAGGAGCCCCGCCGACCCTTCTACATCAACAACAATAT
TCCCGAAATCCCGAAGGACTGTGTGGCGCAGTTCAAGTGCAAAAAGAAGC
TGGCGAATGTTCAGGCTCCAAAACCGTGTGTGAAATACTGCCTGCACAGG
ATCACCTGTCCCAATAACCAGACCAGTCCCGTTCAGCCCAACCAGTGTGT
CGATCTCGACGAGCAACAGGTGCTGGCCGTCCACGAGGCAAACACGGAGC
CTCCGGTCGCCGGCCAAACCACCACCGAGAAGACCATGATGGTGGCCATG
ATCGACTTCCCCTGCCAGCCCGGCTATCTGCCCGACCATCGTGGTCGCTG
TCGGGAAATCTGGTGATTCGATGGCTTCGTGACACGTGTTTACTGCATAA
TTATACCTGTGGAATTTTCGTTTTTATATACATGCCTGCTCCCAATAATC
ACAATAAAACCCAAACGAACGGCTTTTGCCCAAAAAAAAAAAAAAAA

RH17470.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:19:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG17244-RA 632 CG17244-RA 3..632 2..631 3150 100 Plus
CG17244.a 581 CG17244.a 277..581 327..631 1525 100 Plus
CG17244.a 581 CG17244.a 3..276 2..275 1370 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:42:15
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 18800689..18801318 2..631 3075 99.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:23:36 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:42:14
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 22977273..22977905 2..634 3165 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:58:27
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 22718104..22718736 2..634 3165 100 Plus
Blast to na_te.dros performed on 2019-03-15 16:42:14 has no hits.

RH17470.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:42:58 Download gff for RH17470.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 18800687..18801318 1..631 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:42:35 Download gff for RH17470.complete
Subject Subject Range Query Range Percent Splice Strand
CG17244-RA 1..480 37..516 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:49:23 Download gff for RH17470.complete
Subject Subject Range Query Range Percent Splice Strand
CG17244-RA 1..480 37..516 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:08:22 Download gff for RH17470.complete
Subject Subject Range Query Range Percent Splice Strand
CG17244-RA 1..480 37..516 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:40:43 Download gff for RH17470.complete
Subject Subject Range Query Range Percent Splice Strand
CG17244-RA 1..480 37..516 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:47:04 Download gff for RH17470.complete
Subject Subject Range Query Range Percent Splice Strand
CG17244-RA 1..480 37..516 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:02:03 Download gff for RH17470.complete
Subject Subject Range Query Range Percent Splice Strand
CG17244-RA 1..621 1..620 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:49:23 Download gff for RH17470.complete
Subject Subject Range Query Range Percent Splice Strand
CG17244-RA 1..621 1..620 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:08:22 Download gff for RH17470.complete
Subject Subject Range Query Range Percent Splice Strand
CG17244-RA 2..633 1..631 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:40:43 Download gff for RH17470.complete
Subject Subject Range Query Range Percent Splice Strand
CG17244-RA 1..621 1..620 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:47:04 Download gff for RH17470.complete
Subject Subject Range Query Range Percent Splice Strand
CG17244-RA 2..633 1..631 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:42:58 Download gff for RH17470.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22977271..22977902 1..631 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:42:58 Download gff for RH17470.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22977271..22977902 1..631 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:42:58 Download gff for RH17470.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22977271..22977902 1..631 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:08:22 Download gff for RH17470.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 18802993..18803624 1..631 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:11:11 Download gff for RH17470.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22718102..22718733 1..631 99   Plus

RH17470.pep Sequence

Translation from 36 to 515

> RH17470.pep
MKRFLVALLAALLVAAVQGGILGRIFHRESTSTTTSTTTTTTEEPRRPFY
INNNIPEIPKDCVAQFKCKKKLANVQAPKPCVKYCLHRITCPNNQTSPVQ
PNQCVDLDEQQVLAVHEANTEPPVAGQTTTEKTMMVAMIDFPCQPGYLPD
HRGRCREIW*

RH17470.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 06:35:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16717-PA 155 GF16717-PA 1..155 1..159 583 72.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 06:35:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11173-PA 156 GG11173-PA 1..156 1..159 518 75.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 06:35:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22356-PA 160 GH22356-PA 12..160 10..159 460 60.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:39:14
Subject Length Description Subject Range Query Range Score Percent Strand
Gbp3-PB 159 CG17244-PB 1..159 1..159 856 100 Plus
Gbp3-PA 159 CG17244-PA 1..159 1..159 856 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 06:35:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21999-PA 157 GI21999-PA 1..157 1..159 419 56.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 06:35:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26475-PA 156 GM26475-PA 1..156 1..159 654 89.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 06:35:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20991-PA 156 GD20991-PA 1..156 1..159 618 88.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 06:35:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14354-PA 158 GJ14354-PA 6..158 4..159 448 58 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 06:36:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11480-PA 159 GK11480-PA 4..159 2..159 462 55.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 06:36:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10341-PA 163 GE10341-PA 1..163 1..159 542 76.7 Plus

RH17470.hyp Sequence

Translation from 36 to 515

> RH17470.hyp
MKRFLVALLAALLVAAVQGGILGRIFHRESTSTTTSTTTTTTEEPRRPFY
INNNIPEIPKDCVAQFKCKKKLANVQAPKPCVKYCLHRITCPNNQTSPVQ
PNQCVDLDEQQVLAVHEANTEPPVAGQTTTEKTMMVAMIDFPCQPGYLPD
HRGRCREIW*

RH17470.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:39:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG17244-PB 159 CG17244-PB 1..159 1..159 856 100 Plus
CG17244-PA 159 CG17244-PA 1..159 1..159 856 100 Plus