Clone RH17480 Report

Search the DGRC for RH17480

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:174
Well:80
Vector:pFlc-1
Associated Gene/TranscriptCG32442-RB
Protein status:RH17480.pep: gold
Sequenced Size:849

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG32442 2002-10-24 Blastp of sequenced clone
CG32442 2003-01-01 Sim4 clustering to Release 3
CG32442 2008-04-29 Release 5.5 accounting
CG32442 2008-08-15 Release 5.9 accounting
CG32442 2008-12-18 5.12 accounting

Clone Sequence Records

RH17480.complete Sequence

849 bp (849 high quality bases) assembled on 2002-10-24

GenBank Submission: BT001779

> RH17480.complete
GGTTTGTTTTTCGGGCAGCCCAATGAAACTTTAAATGGATGCAAAATGTC
CGAAAAGAAGCGATTTGTGTGCGTTAATTGTGGACACAGAGTAAAAGAAC
TGTTCAAGAAATACAGCAATACTATGAAAACCACGCAATGCGACAACTGT
CACCAAATCACGGATAAATACATTGAGTTCGAGGAGTTTATCATATTAAT
AGATGCACTGCTATTAGATTCGTGCGCCTTCCGGCACATTATATACAATG
GCGACTTTAAGGTGACGAGCTCTACTGGAAGGTTTCGCTGGTGGTGCTGC
TCCTGGAATCCTTTGCGCTGTGCCGCCAAAAACTGCCCGACCCTCCGAAT
GCCTCTTTGCATGTCCACGAAAAGGGCTTTTACACATATACCCTTCAAAA
CATGGGAGATTACATGTTCATGACTCTATTGCTGCTAATAATCACCGCCA
CTCTGAGTATTGATTGGATGCAGAAAATAGGCTTTCGAAATTTTTCTTTA
ATTATACTCAAAGTGGTGCTGATATCCAACCTGTCCAAGTTCTTCCTTCT
GCCCATTTTGGTGTGGCAAAATAACACGACCGTTTTTGGCCGGAACTTGC
ACCATCTTCTGGTCATGGGACATCACCTCTGCTCCCTGGTCCTCGCCTAC
CAGGCAGTCGGAGCCACTAGGAAGAACCTTCGATGGTGGGCTCTAACTTT
GGTTGTTATAGCTTTCGCCTTCAAGGAAACCGCGAGGCAGTTTGTATCAC
TAGTGGTGGAGGACAATTGATTATAGAAGGCTGAAAATAGTAAACCAAAA
TTTTATTTAACAAAAATATAACTCTTCAAAGACAAAAAAAAAAAAAAAA

RH17480.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:37:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG32442-RB 920 CG32442-RB 27..859 2..834 4150 99.8 Plus
CG32442-RA 1143 CG32442-RA 486..1052 268..834 2820 99.8 Plus
CG32442-RC 966 CG32442-RC 351..905 280..834 2760 99.8 Plus
CG32442-RC 966 CG32442-RC 85..352 2..269 1340 100 Plus
CG32442-RA 1143 CG32442-RA 228..487 2..261 1300 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:31:27
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 21517215..21517641 833..407 2120 99.8 Minus
chr3L 24539361 chr3L 21517705..21517845 408..268 705 100 Minus
chr3L 24539361 chr3L 21518080..21518220 142..2 705 100 Minus
chr3L 24539361 chr3L 21517893..21518020 269..142 640 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:23:38 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:31:25
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 21528279..21528706 834..407 2125 99.8 Minus
3L 28110227 3L 21528770..21528910 408..268 705 100 Minus
3L 28110227 3L 21529145..21529285 142..2 705 100 Minus
3L 28110227 3L 21528958..21529085 269..142 640 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:11:28
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 21521379..21521806 834..407 2125 99.7 Minus
3L 28103327 3L 21522245..21522385 142..2 705 100 Minus
3L 28103327 3L 21521870..21522010 408..268 705 100 Minus
3L 28103327 3L 21522058..21522185 269..142 640 100 Minus
Blast to na_te.dros performed 2019-03-15 20:31:26
Subject Length Description Subject Range Query Range Score Percent Strand
297 6995 297 DMIS297 6995bp Derived from X03431 (g8146) (Rel. 36, Last updated, Version 2). 2747..2820 722..795 108 64 Plus

RH17480.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:32:28 Download gff for RH17480.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 21517215..21517639 409..833 99 <- Minus
chr3L 21517705..21517843 270..408 100 <- Minus
chr3L 21517893..21518020 142..269 100 <- Minus
chr3L 21518081..21518220 1..141 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:42:36 Download gff for RH17480.complete
Subject Subject Range Query Range Percent Splice Strand
CG32442-RA 1..717 46..770 98   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:09:11 Download gff for RH17480.complete
Subject Subject Range Query Range Percent Splice Strand
CG32442-RA 1..717 46..770 98   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:14:55 Download gff for RH17480.complete
Subject Subject Range Query Range Percent Splice Strand
CG32442-RA 1..717 46..770 98   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:00:06 Download gff for RH17480.complete
Subject Subject Range Query Range Percent Splice Strand
CG32442-RA 1..717 46..770 98   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:23:20 Download gff for RH17480.complete
Subject Subject Range Query Range Percent Splice Strand
CG32442-RA 1..717 46..770 98   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:29:57 Download gff for RH17480.complete
Subject Subject Range Query Range Percent Splice Strand
CG32442-RB 20..853 1..833 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:09:11 Download gff for RH17480.complete
Subject Subject Range Query Range Percent Splice Strand
CG32442-RB 20..853 1..833 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:14:55 Download gff for RH17480.complete
Subject Subject Range Query Range Percent Splice Strand
CG32442-RB 47..880 1..833 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:00:07 Download gff for RH17480.complete
Subject Subject Range Query Range Percent Splice Strand
CG32442-RB 20..853 1..833 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:23:20 Download gff for RH17480.complete
Subject Subject Range Query Range Percent Splice Strand
CG32442-RB 47..880 1..833 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:32:28 Download gff for RH17480.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21528958..21529085 142..269 100 <- Minus
3L 21529146..21529285 1..141 99   Minus
3L 21528770..21528908 270..408 100 <- Minus
3L 21528280..21528704 409..833 99 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:32:28 Download gff for RH17480.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21528958..21529085 142..269 100 <- Minus
3L 21529146..21529285 1..141 99   Minus
3L 21528770..21528908 270..408 100 <- Minus
3L 21528280..21528704 409..833 99 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:32:28 Download gff for RH17480.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21528958..21529085 142..269 100 <- Minus
3L 21529146..21529285 1..141 99   Minus
3L 21528770..21528908 270..408 100 <- Minus
3L 21528280..21528704 409..833 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:14:55 Download gff for RH17480.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 21521380..21521804 409..833 99 <- Minus
arm_3L 21521870..21522008 270..408 100 <- Minus
arm_3L 21522058..21522185 142..269 100 <- Minus
arm_3L 21522246..21522385 1..141 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:31:35 Download gff for RH17480.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21521380..21521804 409..833 99 <- Minus
3L 21521870..21522008 270..408 100 <- Minus
3L 21522058..21522185 142..269 100 <- Minus
3L 21522246..21522385 1..141 99   Minus

RH17480.hyp Sequence

Translation from 3 to 422

> RH17480.hyp
LFFGQPNETLNGCKMSEKKRFVCVNCGHRVKELFKKYSNTMKTTQCDNCH
QITDKYIEFEEFIILIDALLLDSCAFRHIIYNGDFKVTSSTGRFRWWCCS
WNPLRCAAKNCPTLRMPLCMSTKRAFTHIPFKTWEITCS*

RH17480.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:56:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG32442-PB 125 CG32442-PB 1..125 15..139 708 100 Plus
CG32442-PC 121 CG32442-PC 1..121 15..139 674 96.8 Plus
CG32442-PA 238 CG32442-PA 1..73 15..87 393 98.6 Plus

RH17480.pep Sequence

Translation from 45 to 422

> RH17480.pep
MSEKKRFVCVNCGHRVKELFKKYSNTMKTTQCDNCHQITDKYIEFEEFII
LIDALLLDSCAFRHIIYNGDFKVTSSTGRFRWWCCSWNPLRCAAKNCPTL
RMPLCMSTKRAFTHIPFKTWEITCS*

RH17480.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:22:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10706-PA 240 GF10706-PA 1..73 1..73 347 84.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:22:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13227-PA 239 GG13227-PA 3..72 4..73 356 92.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:22:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16742-PA 240 GH16742-PA 7..75 5..73 261 69.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:26:36
Subject Length Description Subject Range Query Range Score Percent Strand
Arv1-PB 125 CG32442-PB 1..125 1..125 708 100 Plus
Arv1-PC 121 CG32442-PC 1..121 1..125 674 96.8 Plus
Arv1-PA 238 CG32442-PA 1..73 1..73 393 98.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:22:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13467-PA 240 GI13467-PA 6..75 4..73 260 70 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:22:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11902-PA 206 GL11902-PA 1..41 33..73 201 87.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:22:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16907-PA 238 GA16907-PA 1..73 1..73 326 80.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:22:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22132-PA 240 GM22132-PA 1..73 1..73 378 94.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:22:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12111-PA 240 GD12111-PA 1..73 1..73 381 95.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:22:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11830-PA 240 GJ11830-PA 6..75 4..73 273 72.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:23:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17511-PA 240 GK17511-PA 7..75 5..73 331 85.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:23:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22323-PA 240 GE22323-PA 1..73 1..73 375 94.5 Plus
Dyak\GE23005-PA 141 GE23005-PA 1..73 1..73 370 94.5 Plus