Clone RH17496 Report

Search the DGRC for RH17496

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:174
Well:96
Vector:pFlc-1
Associated Gene/TranscriptCG12203-RA
Protein status:RH17496.pep: gold
Preliminary Size:668
Sequenced Size:782

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12203 2001-12-13 Blastp of sequenced clone
CG12203 2002-01-01 Sim4 clustering to Release 2
CG12203 2003-01-01 Sim4 clustering to Release 3
CG12203 2008-04-29 Release 5.5 accounting
CG12203 2008-08-15 Release 5.9 accounting
CG12203 2008-12-18 5.12 accounting

Clone Sequence Records

RH17496.complete Sequence

782 bp (782 high quality bases) assembled on 2001-12-13

GenBank Submission: AY070680

> RH17496.complete
GTTCGGCACTGGCGAACAGCTGTTTTCACAATCGGAAAGCGCTTGTGTTC
CAAATTTTACGTAATTCGTATTTTGAAGCCGATTTCTGCCGTGTAGCCCC
AAACGCCTAGCGAAATGTCGGCCCTCCGCCAAGTGATGTGCAGAAGCACC
GCCTCCCTGCAGCTGTACCAGGCCAACAGGGCAGCCGCTGCCCGCTGGGC
ATCCACCGCCACGGACGGCGGTCCGCTGGACCCCAAGACGGCCCTGGCCC
GCCCCGAAGAGCTGGAGCAGCGCAACAAGCTGAGTGGCAAGATCACCGTG
CCGACTGCCGTCAATCTCAGCCCGATCAGCGGCGTTCCGGAGGAGCACAT
TCGGGAGCGCCGTGTGCGCATCCATATTCCGCCCAAGAACGCAATGCAGA
GCGGCACCGATAACGTGAACACCTGGCAAATCGAGTTCGACAACCGCGAG
CGCTGGGAGAATCCGCTCATGGGCTGGGCCTCCAGCGGCGACCCATTGTC
CAACATGAACGTGCAGTTCGGATCCCCAGAGGAGGCCATCACGTTCTGCG
AACGGAACGGATGGCGCTGGTACGTCGACGGCGCCGCGAAGCCCAAGAAG
GAGCGCGTCAAGAACTACGGCATCAACTTTGCCTGGAACAAGCGCACGCG
CGTCTCCACCAAGTAGACGCTCCCCGCAGCTAGCCAGGATTATAGACCAC
AATTATCTGATTTTTTTTTTGCTTTGTTCATTATCTGAGTACCCAAATAA
ACAGTCGGCTGGACTCAAAAAAAAAAAAAAAA

RH17496.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:48:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG12203-RA 910 CG12203-RA 128..892 5..769 3795 99.7 Plus
CG12204-RA 1112 CG12204-RA 1062..1112 769..719 255 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:51:40
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 19381476..19381796 165..485 1590 99.7 Plus
chrX 22417052 chrX 19381851..19382136 481..766 1430 100 Plus
chrX 22417052 chrX 19381226..19381388 5..167 785 98.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:23:39 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:51:38
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 19492677..19492997 165..485 1605 100 Plus
X 23542271 X 19493052..19493340 481..769 1445 100 Plus
X 23542271 X 19492427..19492589 5..167 785 98.8 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:14:39
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 19500775..19501095 165..485 1605 100 Plus
X 23527363 X 19501150..19501438 481..769 1445 100 Plus
X 23527363 X 19500525..19500687 5..167 785 98.7 Plus
Blast to na_te.dros performed on 2019-03-16 19:51:39 has no hits.

RH17496.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:52:56 Download gff for RH17496.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 19381223..19381385 1..164 96 -> Plus
chrX 19381476..19381796 165..485 99 -> Plus
chrX 19381856..19382136 486..766 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:42:37 Download gff for RH17496.complete
Subject Subject Range Query Range Percent Splice Strand
CG12203-RA 1..552 115..666 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:16:47 Download gff for RH17496.complete
Subject Subject Range Query Range Percent Splice Strand
CG12203-RA 1..552 115..666 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:35:01 Download gff for RH17496.complete
Subject Subject Range Query Range Percent Splice Strand
CG12203-RA 1..552 115..666 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:42:54 Download gff for RH17496.complete
Subject Subject Range Query Range Percent Splice Strand
CG12203-RA 1..552 115..666 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:44:03 Download gff for RH17496.complete
Subject Subject Range Query Range Percent Splice Strand
CG12203-RA 1..552 115..666 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:49:14 Download gff for RH17496.complete
Subject Subject Range Query Range Percent Splice Strand
CG12203-RA 3..766 4..766 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:16:47 Download gff for RH17496.complete
Subject Subject Range Query Range Percent Splice Strand
CG12203-RA 3..766 4..766 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:35:01 Download gff for RH17496.complete
Subject Subject Range Query Range Percent Splice Strand
CG12203-RA 4..768 1..766 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:42:54 Download gff for RH17496.complete
Subject Subject Range Query Range Percent Splice Strand
CG12203-RA 3..766 4..766 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:44:03 Download gff for RH17496.complete
Subject Subject Range Query Range Percent Splice Strand
CG12203-RA 4..768 1..766 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:52:56 Download gff for RH17496.complete
Subject Subject Range Query Range Percent Splice Strand
X 19493057..19493337 486..766 100   Plus
X 19492677..19492997 165..485 100 -> Plus
X 19492424..19492586 1..164 96 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:52:56 Download gff for RH17496.complete
Subject Subject Range Query Range Percent Splice Strand
X 19493057..19493337 486..766 100   Plus
X 19492677..19492997 165..485 100 -> Plus
X 19492424..19492586 1..164 96 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:52:56 Download gff for RH17496.complete
Subject Subject Range Query Range Percent Splice Strand
X 19493057..19493337 486..766 100   Plus
X 19492677..19492997 165..485 100 -> Plus
X 19492424..19492586 1..164 96 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:35:01 Download gff for RH17496.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 19386457..19386619 1..164 96 -> Plus
arm_X 19386710..19387030 165..485 100 -> Plus
arm_X 19387090..19387370 486..766 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:19:00 Download gff for RH17496.complete
Subject Subject Range Query Range Percent Splice Strand
X 19500775..19501095 165..485 100 -> Plus
X 19501155..19501435 486..766 100   Plus
X 19500522..19500684 1..164 96 -> Plus

RH17496.hyp Sequence

Translation from 114 to 665

> RH17496.hyp
MSALRQVMCRSTASLQLYQANRAAAARWASTATDGGPLDPKTALARPEEL
EQRNKLSGKITVPTAVNLSPISGVPEEHIRERRVRIHIPPKNAMQSGTDN
VNTWQIEFDNRERWENPLMGWASSGDPLSNMNVQFGSPEEAITFCERNGW
RWYVDGAAKPKKERVKNYGINFAWNKRTRVSTK*

RH17496.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:14:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG12203-PA 183 CG12203-PA 1..183 1..183 977 100 Plus

RH17496.pep Sequence

Translation from 114 to 665

> RH17496.pep
MSALRQVMCRSTASLQLYQANRAAAARWASTATDGGPLDPKTALARPEEL
EQRNKLSGKITVPTAVNLSPISGVPEEHIRERRVRIHIPPKNAMQSGTDN
VNTWQIEFDNRERWENPLMGWASSGDPLSNMNVQFGSPEEAITFCERNGW
RWYVDGAAKPKKERVKNYGINFAWNKRTRVSTK*

RH17496.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:33:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20193-PA 181 GF20193-PA 1..181 1..183 843 86.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:33:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19227-PA 184 GG19227-PA 1..184 1..183 945 97.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:33:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17652-PA 175 GH17652-PA 1..175 1..183 754 75.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:11:41
Subject Length Description Subject Range Query Range Score Percent Strand
ND-18-PA 183 CG12203-PA 1..183 1..183 977 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:33:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16090-PA 176 GI16090-PA 1..176 1..183 774 78.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:33:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14531-PA 181 GL14531-PA 1..181 1..183 795 80.9 Plus
Dper\GL13999-PA 182 GL13999-PA 1..182 1..183 692 70.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:33:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11474-PA 181 GA11474-PA 1..181 1..183 795 80.9 Plus
Dpse\GA26927-PA 182 GA26927-PA 1..182 1..183 692 70.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:33:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22960-PA 183 GM22960-PA 1..183 1..183 965 98.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:33:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17444-PA 183 GD17444-PA 1..183 1..183 962 97.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:33:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15739-PA 176 GJ15739-PA 1..176 1..183 764 78.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:33:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25430-PA 176 GK25430-PA 1..176 1..183 754 77.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:33:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15845-PA 184 GE15845-PA 1..184 1..183 942 96.7 Plus