Clone RH17657 Report

Search the DGRC for RH17657

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:176
Well:57
Vector:pFlc-1
Associated Gene/Transcriptl(3)neo18-RA
Protein status:RH17657.pep: gold
Preliminary Size:647
Sequenced Size:813

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9762 2001-12-13 Blastp of sequenced clone
CG9762 2002-01-01 Sim4 clustering to Release 2
CG9762 2003-01-01 Sim4 clustering to Release 3
l(3)neo18 2008-04-29 Release 5.5 accounting
l(3)neo18 2008-08-15 Release 5.9 accounting
l(3)neo18 2008-12-18 5.12 accounting

Clone Sequence Records

RH17657.complete Sequence

813 bp (813 high quality bases) assembled on 2001-12-13

GenBank Submission: AY070682

> RH17657.complete
GCTGCAAAAAGTGTGACCGTTTGCCGTGCTGCTCGCAACTTTGACACGAC
CAGTTCCAAAATATCGTGAGATTTAAGCAAAACTACTAGAAAATGGTCGG
TTGGAGCCGTTTGCTGTCGCCGGCGGCGAAGTTCGCCAGCTACCGGGCTG
TCCTGCAAGAGCCCGCGTGCCGGAATGCCCTGCACCAACAGCTGCGCAGA
ATGGGAGGCGATCATGGACACCACCAAATGATCATCAAGCCATCCCGCTT
CCAGTGGGACAAGTTCAAGGATCTGTTGCACTTTTACGTAATGCTCGGCG
TCATCCCAGTCACCGCATTGGTTCTCTACGCGAACATCTTTGTGGGACCC
GCGCAGCTCGCCGAGATTCCCGAGGGCTATGAGCCCAAGCACTGGGAGTA
CGAGAAGCACCCCATCTCGCGCTTTATTTCCCGCTACATTTTGAACTCGG
ATCAGCAAAACTACGAGAAATCCCTGCACTATCTCTACGAGGAGAACGAA
AAAGCCCAGATTCGACTCCTTGAGGACGAAGTACGTCGCAAGATGTCGGA
GCGCAATGATTACCAGGCCTACTACTACCGACCATCGGTGGCCAAGTACC
ACAGGATTTCGAAAGAGGCTGCTGACGAGCTGGAGGCTCTGCGCGGAGAC
TAGAACCCTTGTAATATTCTTTAAATACCATTGTTAGGATCCCGTTTTGT
GGGAAATAAAGTGTGAAATCGACTTCGCAACATCATCTTATTCACATTTA
ATAATATAAAAATTACACAGTAGTCGAATAAATACTTAAGACTTAGCAAA
AAAAAAAAAAAAA

RH17657.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:48:19
Subject Length Description Subject Range Query Range Score Percent Strand
l(3)neo18-RA 965 l(3)neo18-RA 145..943 2..800 3980 99.8 Plus
l(3)neo18.a 910 l(3)neo18.a 93..498 2..407 2015 99.7 Plus
l(3)neo18.a 910 l(3)neo18.a 516..910 406..800 1975 100 Plus
Atg12-RB 674 Atg12-RB 596..674 800..722 395 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:09:51
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 12128245..12128528 797..514 1420 100 Minus
chr3L 24539361 chr3L 12128765..12128995 407..177 1155 100 Minus
chr3L 24539361 chr3L 12129066..12129241 177..2 865 99.4 Minus
chr3L 24539361 chr3L 12128587..12128695 514..406 545 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:23:44 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:09:49
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 12137493..12137779 800..514 1435 100 Minus
3L 28110227 3L 12138016..12138246 407..177 1155 100 Minus
3L 28110227 3L 12138317..12138492 177..2 865 99.4 Minus
3L 28110227 3L 12137838..12137946 514..406 545 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:14:32
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 12130593..12130879 800..514 1435 100 Minus
3L 28103327 3L 12131116..12131346 407..177 1155 100 Minus
3L 28103327 3L 12131417..12131592 177..2 865 99.4 Minus
3L 28103327 3L 12130938..12131046 514..406 545 100 Minus
Blast to na_te.dros performed on 2019-03-16 14:09:49 has no hits.

RH17657.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:11:08 Download gff for RH17657.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 12128245..12128527 515..797 100 <- Minus
chr3L 12128587..12128693 408..514 100 <- Minus
chr3L 12128765..12128994 178..407 100 <- Minus
chr3L 12129066..12129241 1..177 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:42:41 Download gff for RH17657.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)neo18-RA 1..561 93..653 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:16:36 Download gff for RH17657.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)neo18-RA 1..561 93..653 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 14:52:06 Download gff for RH17657.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)neo18-RA 1..561 93..653 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:42:43 Download gff for RH17657.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)neo18-RA 1..561 93..653 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:24:15 Download gff for RH17657.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)neo18-RA 1..561 93..653 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:48:58 Download gff for RH17657.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)neo18-RA 91..888 1..797 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:16:36 Download gff for RH17657.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)neo18-RA 91..888 1..797 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 14:52:06 Download gff for RH17657.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)neo18-RA 91..888 1..797 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:42:44 Download gff for RH17657.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)neo18-RA 91..888 1..797 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:24:15 Download gff for RH17657.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)neo18-RA 91..888 1..797 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:11:08 Download gff for RH17657.complete
Subject Subject Range Query Range Percent Splice Strand
3L 12137496..12137778 515..797 100 <- Minus
3L 12137838..12137944 408..514 100 <- Minus
3L 12138016..12138245 178..407 100 <- Minus
3L 12138317..12138492 1..177 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:11:08 Download gff for RH17657.complete
Subject Subject Range Query Range Percent Splice Strand
3L 12137496..12137778 515..797 100 <- Minus
3L 12137838..12137944 408..514 100 <- Minus
3L 12138016..12138245 178..407 100 <- Minus
3L 12138317..12138492 1..177 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:11:08 Download gff for RH17657.complete
Subject Subject Range Query Range Percent Splice Strand
3L 12137496..12137778 515..797 100 <- Minus
3L 12137838..12137944 408..514 100 <- Minus
3L 12138016..12138245 178..407 100 <- Minus
3L 12138317..12138492 1..177 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 14:52:06 Download gff for RH17657.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 12130596..12130878 515..797 100 <- Minus
arm_3L 12130938..12131044 408..514 100 <- Minus
arm_3L 12131116..12131345 178..407 100 <- Minus
arm_3L 12131417..12131592 1..177 98   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:18:48 Download gff for RH17657.complete
Subject Subject Range Query Range Percent Splice Strand
3L 12130596..12130878 515..797 100 <- Minus
3L 12130938..12131044 408..514 100 <- Minus
3L 12131116..12131345 178..407 100 <- Minus
3L 12131417..12131592 1..177 98   Minus

RH17657.hyp Sequence

Translation from 92 to 652

> RH17657.hyp
MVGWSRLLSPAAKFASYRAVLQEPACRNALHQQLRRMGGDHGHHQMIIKP
SRFQWDKFKDLLHFYVMLGVIPVTALVLYANIFVGPAQLAEIPEGYEPKH
WEYEKHPISRFISRYILNSDQQNYEKSLHYLYEENEKAQIRLLEDEVRRK
MSERNDYQAYYYRPSVAKYHRISKEAADELEALRGD*

RH17657.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:17:59
Subject Length Description Subject Range Query Range Score Percent Strand
l(3)neo18-PB 186 CG9762-PB 1..186 1..186 989 100 Plus
l(3)neo18-PA 186 CG9762-PA 1..186 1..186 989 100 Plus

RH17657.pep Sequence

Translation from 92 to 652

> RH17657.pep
MVGWSRLLSPAAKFASYRAVLQEPACRNALHQQLRRMGGDHGHHQMIIKP
SRFQWDKFKDLLHFYVMLGVIPVTALVLYANIFVGPAQLAEIPEGYEPKH
WEYEKHPISRFISRYILNSDQQNYEKSLHYLYEENEKAQIRLLEDEVRRK
MSERNDYQAYYYRPSVAKYHRISKEAADELEALRGD*

RH17657.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:32:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF25001-PA 186 GF25001-PA 1..186 1..186 928 90.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:32:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13853-PA 186 GG13853-PA 1..186 1..186 959 95.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:32:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15309-PA 186 GH15309-PA 1..186 1..186 842 80.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:04:59
Subject Length Description Subject Range Query Range Score Percent Strand
ND-SGDH-PB 186 CG9762-PB 1..186 1..186 989 100 Plus
ND-SGDH-PA 186 CG9762-PA 1..186 1..186 989 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:32:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12904-PA 186 GI12904-PA 1..186 1..186 860 84.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:32:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25017-PA 186 GL25017-PA 1..186 1..186 896 87.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:32:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22016-PA 186 GA22016-PA 1..186 1..186 896 87.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:32:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24678-PA 186 GM24678-PA 1..186 1..186 978 97.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:32:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12746-PA 186 GD12746-PA 1..186 1..186 977 97.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:32:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13044-PA 186 GJ13044-PA 1..186 1..186 859 84.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:32:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16642-PA 186 GK16642-PA 1..186 1..186 895 87.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:32:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\l(3)neo18-PA 186 GE20147-PA 1..186 1..186 960 95.2 Plus