Clone RH17958 Report

Search the DGRC for RH17958

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:179
Well:58
Vector:pFlc-1
Associated Gene/TranscriptCG6770-RA
Protein status:RH17958.pep: gold
Sequenced Size:788

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6770-RA 2009-01-21 est gleaning
CG6770 2009-06-08 Manual selection by Joe Carlson

Clone Sequence Records

RH17958.complete Sequence

788 bp assembled on 2009-08-10

GenBank Submission: BT099526.1

> RH17958.complete
GAATTCCGTTCGCAGCTCAGCGAAAAGTGAACAAAAAAAAGCAGAAGAGA
AATTTGGAAAGCAGCCTGCAAGTTTGCAGAGAAACAAAAAGCAGACACCA
ACCAAGAACGCAGTTAGTTTTGCAACCTTAAATCGCCATTATGTCCGAGG
CCCACTTCGATGAGTACGAGCACTACAACTTCGACCATGACAAGCACATC
TTCTCTGGACACAGCGGCAAGCAGCGCAACAAGAGGGAGGCCAATGAGCA
CACCAACCACTTCGATCCCTCCGGTCATTCCCGCAAGATTCTGACCAAGC
TGATGAACACCAACAACAACAACAAGAAAGCCGCCGCCTGCAAGAACTGA
TGCAGGGCATCGACGGAGGCGGTGGAACAGGAGAGAAAGAAGTAACGGGG
CCGCGCTGAAAGGAGAAAAGAAATCTTCGAATTTAAAAGGAAAGCAAAAG
CAAAGGAGAGAAGAAAAAGAAGAACAAGCAGCAGTTTTGCTGGAAGGAAA
GAAAGAAAAACAAAAGCCAGCTGGAAATACACATTGCATTTGTATTGTGC
ATTGGCTTTTCATGCGGCGCTAAACTTTGTGAACATTATAATAATTTTAT
TTCGCTTATAATTTCACAAACACAAAAAAAGAAAGGCACATACTACTCTT
AGCTTCTAATATATTCCTAAACTAATTCAGACTTGCAAGTTTTAGTTGCT
AAGCCTTAGAGCGTTTCAAATAATGAAGTTTGACTTAGGTAATACATATA
AAATAAAGAGAAAACCAAAACTGAAAAAAAAAAAAAAA

RH17958.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:29:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG6770-RA 755 CG6770-RA 1..755 16..770 3775 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:08:14
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 12044027..12044797 773..2 3795 99.7 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:23:48 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:08:12
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 12045341..12046114 775..2 3870 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:25:27
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 12045341..12046114 775..2 3870 100 Minus
Blast to na_te.dros performed on 2019-03-16 04:08:12 has no hits.

RH17958.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:08:50 Download gff for RH17958.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 12044027..12044797 1..773 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:13:24 Download gff for RH17958.complete
Subject Subject Range Query Range Percent Splice Strand
CG6770-RA 1..210 141..350 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:57:21 Download gff for RH17958.complete
Subject Subject Range Query Range Percent Splice Strand
CG6770-RA 1..210 141..350 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:18:13 Download gff for RH17958.complete
Subject Subject Range Query Range Percent Splice Strand
CG6770-RA 1..210 141..350 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:28:22 Download gff for RH17958.complete
Subject Subject Range Query Range Percent Splice Strand
CG6770-RA 1..210 141..350 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-08-10 15:00:18 Download gff for RH17958.complete
Subject Subject Range Query Range Percent Splice Strand
CG6770-RA 1..734 16..749 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:57:21 Download gff for RH17958.complete
Subject Subject Range Query Range Percent Splice Strand
CG6770-RA 1..734 16..749 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:18:13 Download gff for RH17958.complete
Subject Subject Range Query Range Percent Splice Strand
CG6770-RA 4..776 1..773 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:28:22 Download gff for RH17958.complete
Subject Subject Range Query Range Percent Splice Strand
CG6770-RA 4..776 1..773 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:08:50 Download gff for RH17958.complete
Subject Subject Range Query Range Percent Splice Strand
2L 12045343..12046114 1..773 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:08:50 Download gff for RH17958.complete
Subject Subject Range Query Range Percent Splice Strand
2L 12045343..12046114 1..773 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:08:50 Download gff for RH17958.complete
Subject Subject Range Query Range Percent Splice Strand
2L 12045343..12046114 1..773 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:18:13 Download gff for RH17958.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 12045343..12046114 1..773 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:48:55 Download gff for RH17958.complete
Subject Subject Range Query Range Percent Splice Strand
2L 12045343..12046114 1..773 99   Minus

RH17958.pep Sequence

Translation from 140 to 349

> RH17958.pep
MSEAHFDEYEHYNFDHDKHIFSGHSGKQRNKREANEHTNHFDPSGHSRKI
LTKLMNTNNNNKKAAACKN*

RH17958.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 16:42:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23497-PA 68 GF23497-PA 1..68 1..69 304 95.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 16:42:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10281-PA 68 GG10281-PA 1..68 1..69 343 98.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 16:42:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13777-PA 66 GH13777-PA 1..62 1..62 300 91.9 Plus
Dgri\GH24953-PA 66 GH24953-PA 1..66 1..69 270 78.3 Plus
Dgri\GH10200-PA 66 GH10200-PA 1..66 1..69 270 78.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:52:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG6770-PA 69 CG6770-PA 1..69 1..69 386 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 16:42:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17181-PA 66 GI17181-PA 1..62 1..62 296 90.3 Plus
Dmoj\GI14885-PA 68 GI14885-PA 1..68 1..69 273 85.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 16:42:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14142-PA 68 GL14142-PA 1..68 1..69 297 84.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 16:42:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19852-PA 68 GA19852-PA 1..68 1..69 297 84.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 16:42:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26395-PA 69 GM26395-PA 1..69 1..69 359 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 16:42:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22138-PA 69 GD22138-PA 1..69 1..69 359 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 16:42:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22139-PA 66 GJ22139-PA 1..62 1..62 297 90.3 Plus
Dvir\GJ24028-PA 66 GJ24028-PA 1..66 1..69 280 78.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 16:42:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19032-PA 68 GK19032-PA 1..68 1..69 301 85.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 16:42:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12490-PA 69 GE12490-PA 1..69 1..69 359 100 Plus

RH17958.hyp Sequence

Translation from 140 to 349

> RH17958.hyp
MSEAHFDEYEHYNFDHDKHIFSGHSGKQRNKREANEHTNHFDPSGHSRKI
LTKLMNTNNNNKKAAACKN*

RH17958.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:54:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG6770-PA 69 CG6770-PA 1..69 1..69 386 100 Plus