BDGP Sequence Production Resources |
Search the DGRC for RH18256
Library: | RH |
Tissue Source: | Drosophila melanogaster adult head |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2001-04-30 |
Comments: | Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 182 |
Well: | 56 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG32068-RB |
Protein status: | RH18256.pep: gold |
Sequenced Size: | 708 |
Gene | Date | Evidence |
---|---|---|
CG32068 | 2011-03-18 | Manual selection by Sue Celniker |
708 bp assembled on 2011-04-26
GenBank Submission: BT126384.1
> RH18256.complete GATTTGTTGCTCGTTGCTCGTGAAAACCCGTTTAAAACAGTCCAAAATGG TGCAGGTTTGGTATATGGATACGGAGGAAACCGATCAGCGCCTGGAGCAC CACCGCAATCCGCCTGCCTACTTGGAACTGGATGATCTGTACCAGAAGAC CGGCGTGGAATACTTTAAGATCAATGCGGACGAGTACCAGAGCGATAATA CCCTCACGGAACTGAGGGCAAAACGTGGCTACACCTACGATGATGAGATC ACATGCTCGGAAAAGTGCCTTCCAGACTATGCCAACAAGTTGAAAGCCTT TTTCACCGAACACCTGCACACGGATGAGGAAATTCGCCTGATATTGGAGG GATCCGGTTACTTTGATGTTCGCGACAATGAGGACAACTGGTTGCGCATT AAGGTTGTCAAGGGAGATCTGATCATTATACCAGCTGGCATATATCACCG CTTTACTTTGGATACCAATAACTTTATCAGAACTCGTCGCTATTTTGTGG GCGAACCTGTCTGGGCTCCACACAATCGTCCTGCTGATGAAATGGACTGT CGCAAATCGTACATCAAGCATCAGTCGGAAAACTTTGTGCAATTCAATAA GGTTTAAAAACCTTAAATCTTATCTTTTACCATCAAGTTTGATATTTTGA AATATAAAATCGCTGTGTATAATCAATAAAAAAAAAAAAAAAGAAAAAAA AAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 10655599..10655807 | 470..678 | 1030 | 99.5 | Plus |
chr3L | 24539361 | chr3L | 10654779..10654946 | 2..169 | 825 | 99.4 | Plus |
chr3L | 24539361 | chr3L | 10655166..10655295 | 246..375 | 635 | 99.2 | Plus |
chr3L | 24539361 | chr3L | 10655446..10655539 | 376..469 | 455 | 98.9 | Plus |
chr3L | 24539361 | chr3L | 10655026..10655105 | 168..247 | 385 | 98.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 10664228..10664436 | 470..678 | 1045 | 100 | Plus |
3L | 28110227 | 3L | 10663401..10663568 | 2..169 | 840 | 100 | Plus |
3L | 28110227 | 3L | 10663788..10663917 | 246..375 | 650 | 100 | Plus |
3L | 28110227 | 3L | 10664075..10664168 | 376..469 | 470 | 100 | Plus |
3L | 28110227 | 3L | 10663648..10663727 | 168..247 | 400 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 10657328..10657536 | 470..678 | 1045 | 100 | Plus |
3L | 28103327 | 3L | 10656501..10656668 | 2..169 | 840 | 100 | Plus |
3L | 28103327 | 3L | 10656888..10657017 | 246..375 | 650 | 100 | Plus |
3L | 28103327 | 3L | 10657175..10657268 | 376..469 | 470 | 100 | Plus |
3L | 28103327 | 3L | 10656748..10656827 | 168..247 | 400 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3S18 | 6126 | 3S18 DM23420 6126bp Derived from U23420 (g733531) (Rel. 48, Last updated, Version 3). | 3299..3400 | 544..445 | 136 | 62.1 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 10654778..10654946 | 1..169 | 98 | -> | Plus |
chr3L | 10655028..10655105 | 170..247 | 98 | -> | Plus |
chr3L | 10655168..10655295 | 248..375 | 99 | -> | Plus |
chr3L | 10655446..10655539 | 376..469 | 98 | -> | Plus |
chr3L | 10655599..10655806 | 470..677 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32068-RB | 1..561 | 47..607 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32068-RB | 1..561 | 47..607 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32068-RB | 1..561 | 47..607 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32068-RB | 12..687 | 1..676 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32068-RB | 25..701 | 1..677 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32068-RB | 25..701 | 1..677 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 10663400..10663568 | 1..169 | 99 | -> | Plus |
3L | 10663650..10663727 | 170..247 | 100 | -> | Plus |
3L | 10663790..10663917 | 248..375 | 100 | -> | Plus |
3L | 10664075..10664168 | 376..469 | 100 | -> | Plus |
3L | 10664228..10664435 | 470..677 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 10663400..10663568 | 1..169 | 99 | -> | Plus |
3L | 10663650..10663727 | 170..247 | 100 | -> | Plus |
3L | 10663790..10663917 | 248..375 | 100 | -> | Plus |
3L | 10664075..10664168 | 376..469 | 100 | -> | Plus |
3L | 10664228..10664435 | 470..677 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 10663400..10663568 | 1..169 | 99 | -> | Plus |
3L | 10663650..10663727 | 170..247 | 100 | -> | Plus |
3L | 10663790..10663917 | 248..375 | 100 | -> | Plus |
3L | 10664075..10664168 | 376..469 | 100 | -> | Plus |
3L | 10664228..10664435 | 470..677 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 10656500..10656668 | 1..169 | 99 | -> | Plus |
arm_3L | 10656750..10656827 | 170..247 | 100 | -> | Plus |
arm_3L | 10656890..10657017 | 248..375 | 100 | -> | Plus |
arm_3L | 10657175..10657268 | 376..469 | 100 | -> | Plus |
arm_3L | 10657328..10657535 | 470..677 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 10657328..10657535 | 470..677 | 100 | Plus | |
3L | 10656500..10656668 | 1..169 | 99 | -> | Plus |
3L | 10656750..10656827 | 170..247 | 100 | -> | Plus |
3L | 10656890..10657017 | 248..375 | 100 | -> | Plus |
3L | 10657175..10657268 | 376..469 | 100 | -> | Plus |
Translation from 0 to 606
> RH18256.hyp ICCSLLVKTRLKQSKMVQVWYMDTEETDQRLEHHRNPPAYLELDDLYQKT GVEYFKINADEYQSDNTLTELRAKRGYTYDDEITCSEKCLPDYANKLKAF FTEHLHTDEEIRLILEGSGYFDVRDNEDNWLRIKVVKGDLIIIPAGIYHR FTLDTNNFIRTRRYFVGEPVWAPHNRPADEMDCRKSYIKHQSENFVQFNK V*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG32068-PB | 186 | CG32068-PB | 1..186 | 16..201 | 1015 | 100 | Plus |
Translation from 1 to 606
> RH18256.pep ICCSLLVKTRLKQSKMVQVWYMDTEETDQRLEHHRNPPAYLELDDLYQKT GVEYFKINADEYQSDNTLTELRAKRGYTYDDEITCSEKCLPDYANKLKAF FTEHLHTDEEIRLILEGSGYFDVRDNEDNWLRIKVVKGDLIIIPAGIYHR FTLDTNNFIRTRRYFVGEPVWAPHNRPADEMDCRKSYIKHQSENFVQFNK V*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF10605-PA | 186 | GF10605-PA | 1..186 | 16..201 | 916 | 88.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG15448-PA | 186 | GG15448-PA | 1..186 | 16..201 | 993 | 97.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH15903-PA | 182 | GH15903-PA | 1..174 | 16..189 | 770 | 74.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Adi1-PB | 186 | CG32068-PB | 1..186 | 16..201 | 1015 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI16556-PA | 182 | GI16556-PA | 1..178 | 16..193 | 779 | 75.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL16350-PA | 189 | GL16350-PA | 1..189 | 16..201 | 855 | 83.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA16655-PA | 187 | GA16655-PA | 1..187 | 16..201 | 869 | 84 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM25222-PA | 181 | GM25222-PA | 1..181 | 16..201 | 954 | 95.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14255-PA | 186 | GD14255-PA | 1..186 | 16..201 | 995 | 98.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ12808-PA | 182 | GJ12808-PA | 1..178 | 16..193 | 794 | 77 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK17397-PA | 186 | GK17397-PA | 1..186 | 16..201 | 849 | 80.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE21758-PA | 186 | GE21758-PA | 1..186 | 16..201 | 995 | 98.4 | Plus |