Clone RH18256 Report

Search the DGRC for RH18256

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:182
Well:56
Vector:pFlc-1
Associated Gene/TranscriptCG32068-RB
Protein status:RH18256.pep: gold
Sequenced Size:708

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG32068 2011-03-18 Manual selection by Sue Celniker

Clone Sequence Records

RH18256.complete Sequence

708 bp assembled on 2011-04-26

GenBank Submission: BT126384.1

> RH18256.complete
GATTTGTTGCTCGTTGCTCGTGAAAACCCGTTTAAAACAGTCCAAAATGG
TGCAGGTTTGGTATATGGATACGGAGGAAACCGATCAGCGCCTGGAGCAC
CACCGCAATCCGCCTGCCTACTTGGAACTGGATGATCTGTACCAGAAGAC
CGGCGTGGAATACTTTAAGATCAATGCGGACGAGTACCAGAGCGATAATA
CCCTCACGGAACTGAGGGCAAAACGTGGCTACACCTACGATGATGAGATC
ACATGCTCGGAAAAGTGCCTTCCAGACTATGCCAACAAGTTGAAAGCCTT
TTTCACCGAACACCTGCACACGGATGAGGAAATTCGCCTGATATTGGAGG
GATCCGGTTACTTTGATGTTCGCGACAATGAGGACAACTGGTTGCGCATT
AAGGTTGTCAAGGGAGATCTGATCATTATACCAGCTGGCATATATCACCG
CTTTACTTTGGATACCAATAACTTTATCAGAACTCGTCGCTATTTTGTGG
GCGAACCTGTCTGGGCTCCACACAATCGTCCTGCTGATGAAATGGACTGT
CGCAAATCGTACATCAAGCATCAGTCGGAAAACTTTGTGCAATTCAATAA
GGTTTAAAAACCTTAAATCTTATCTTTTACCATCAAGTTTGATATTTTGA
AATATAAAATCGCTGTGTATAATCAATAAAAAAAAAAAAAAAGAAAAAAA
AAAAAAAA

RH18256.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 10:35:11
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 10655599..10655807 470..678 1030 99.5 Plus
chr3L 24539361 chr3L 10654779..10654946 2..169 825 99.4 Plus
chr3L 24539361 chr3L 10655166..10655295 246..375 635 99.2 Plus
chr3L 24539361 chr3L 10655446..10655539 376..469 455 98.9 Plus
chr3L 24539361 chr3L 10655026..10655105 168..247 385 98.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 10:35:10
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 10664228..10664436 470..678 1045 100 Plus
3L 28110227 3L 10663401..10663568 2..169 840 100 Plus
3L 28110227 3L 10663788..10663917 246..375 650 100 Plus
3L 28110227 3L 10664075..10664168 376..469 470 100 Plus
3L 28110227 3L 10663648..10663727 168..247 400 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:11:28
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 10657328..10657536 470..678 1045 100 Plus
3L 28103327 3L 10656501..10656668 2..169 840 100 Plus
3L 28103327 3L 10656888..10657017 246..375 650 100 Plus
3L 28103327 3L 10657175..10657268 376..469 470 100 Plus
3L 28103327 3L 10656748..10656827 168..247 400 100 Plus
Blast to na_te.dros performed 2019-03-15 10:35:10
Subject Length Description Subject Range Query Range Score Percent Strand
3S18 6126 3S18 DM23420 6126bp Derived from U23420 (g733531) (Rel. 48, Last updated, Version 3). 3299..3400 544..445 136 62.1 Minus

RH18256.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 10:35:56 Download gff for RH18256.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 10654778..10654946 1..169 98 -> Plus
chr3L 10655028..10655105 170..247 98 -> Plus
chr3L 10655168..10655295 248..375 99 -> Plus
chr3L 10655446..10655539 376..469 98 -> Plus
chr3L 10655599..10655806 470..677 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-04-27 15:22:51 Download gff for RH18256.complete
Subject Subject Range Query Range Percent Splice Strand
CG32068-RB 1..561 47..607 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:20:48 Download gff for RH18256.complete
Subject Subject Range Query Range Percent Splice Strand
CG32068-RB 1..561 47..607 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:07:27 Download gff for RH18256.complete
Subject Subject Range Query Range Percent Splice Strand
CG32068-RB 1..561 47..607 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-04-27 15:22:51 Download gff for RH18256.complete
Subject Subject Range Query Range Percent Splice Strand
CG32068-RB 12..687 1..676 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:20:48 Download gff for RH18256.complete
Subject Subject Range Query Range Percent Splice Strand
CG32068-RB 25..701 1..677 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:07:27 Download gff for RH18256.complete
Subject Subject Range Query Range Percent Splice Strand
CG32068-RB 25..701 1..677 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:35:56 Download gff for RH18256.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10663400..10663568 1..169 99 -> Plus
3L 10663650..10663727 170..247 100 -> Plus
3L 10663790..10663917 248..375 100 -> Plus
3L 10664075..10664168 376..469 100 -> Plus
3L 10664228..10664435 470..677 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:35:56 Download gff for RH18256.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10663400..10663568 1..169 99 -> Plus
3L 10663650..10663727 170..247 100 -> Plus
3L 10663790..10663917 248..375 100 -> Plus
3L 10664075..10664168 376..469 100 -> Plus
3L 10664228..10664435 470..677 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:35:56 Download gff for RH18256.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10663400..10663568 1..169 99 -> Plus
3L 10663650..10663727 170..247 100 -> Plus
3L 10663790..10663917 248..375 100 -> Plus
3L 10664075..10664168 376..469 100 -> Plus
3L 10664228..10664435 470..677 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:20:48 Download gff for RH18256.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 10656500..10656668 1..169 99 -> Plus
arm_3L 10656750..10656827 170..247 100 -> Plus
arm_3L 10656890..10657017 248..375 100 -> Plus
arm_3L 10657175..10657268 376..469 100 -> Plus
arm_3L 10657328..10657535 470..677 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:06:41 Download gff for RH18256.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10657328..10657535 470..677 100   Plus
3L 10656500..10656668 1..169 99 -> Plus
3L 10656750..10656827 170..247 100 -> Plus
3L 10656890..10657017 248..375 100 -> Plus
3L 10657175..10657268 376..469 100 -> Plus

RH18256.hyp Sequence

Translation from 0 to 606

> RH18256.hyp
ICCSLLVKTRLKQSKMVQVWYMDTEETDQRLEHHRNPPAYLELDDLYQKT
GVEYFKINADEYQSDNTLTELRAKRGYTYDDEITCSEKCLPDYANKLKAF
FTEHLHTDEEIRLILEGSGYFDVRDNEDNWLRIKVVKGDLIIIPAGIYHR
FTLDTNNFIRTRRYFVGEPVWAPHNRPADEMDCRKSYIKHQSENFVQFNK
V*

RH18256.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:33:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG32068-PB 186 CG32068-PB 1..186 16..201 1015 100 Plus

RH18256.pep Sequence

Translation from 1 to 606

> RH18256.pep
ICCSLLVKTRLKQSKMVQVWYMDTEETDQRLEHHRNPPAYLELDDLYQKT
GVEYFKINADEYQSDNTLTELRAKRGYTYDDEITCSEKCLPDYANKLKAF
FTEHLHTDEEIRLILEGSGYFDVRDNEDNWLRIKVVKGDLIIIPAGIYHR
FTLDTNNFIRTRRYFVGEPVWAPHNRPADEMDCRKSYIKHQSENFVQFNK
V*

RH18256.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 18:49:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10605-PA 186 GF10605-PA 1..186 16..201 916 88.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 18:49:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15448-PA 186 GG15448-PA 1..186 16..201 993 97.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 18:49:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15903-PA 182 GH15903-PA 1..174 16..189 770 74.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:34:29
Subject Length Description Subject Range Query Range Score Percent Strand
Adi1-PB 186 CG32068-PB 1..186 16..201 1015 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 18:49:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16556-PA 182 GI16556-PA 1..178 16..193 779 75.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 18:49:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16350-PA 189 GL16350-PA 1..189 16..201 855 83.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 18:49:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16655-PA 187 GA16655-PA 1..187 16..201 869 84 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 18:49:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25222-PA 181 GM25222-PA 1..181 16..201 954 95.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 18:49:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14255-PA 186 GD14255-PA 1..186 16..201 995 98.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 18:49:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12808-PA 182 GJ12808-PA 1..178 16..193 794 77 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 18:49:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17397-PA 186 GK17397-PA 1..186 16..201 849 80.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 18:49:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21758-PA 186 GE21758-PA 1..186 16..201 995 98.4 Plus