Clone RH18694 Report

Search the DGRC for RH18694

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:186
Well:94
Vector:pFlc-1
Associated Gene/TranscriptCG8066-RA
Protein status:RH18694.pep: gold
Preliminary Size:418
Sequenced Size:1154

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8066 2002-01-01 Sim4 clustering to Release 2
CG8066 2002-11-12 Blastp of sequenced clone
CG8066 2008-04-29 Release 5.5 accounting
CG8066 2008-08-15 Release 5.9 accounting
CG8066 2008-12-18 5.12 accounting

Clone Sequence Records

RH18694.complete Sequence

1154 bp (1154 high quality bases) assembled on 2002-11-12

GenBank Submission: AY089658

> RH18694.complete
GGTTGAGTTTTGCTACTATCGCCGCCATGTCCAACGTTCCAATTGTAGGC
GGGATCAGTCAGCTGGAGGGGAATGAGAGGAAGGAGGCTCTGGAACTCCT
CGATGCCACCCTCGCACAGTTGGCCAACGGAGATGGACCCAGCTACAAGG
CACTTAATGTAACCTCTGTGACGGGTCAGGTCGTAGCTGGAAGACTCAAC
ACCTACGAGGTGCAGCTGGACAATGGATCCGAGATAAAACAGGGCACTGT
GCAGATCTGGAGTCGCGCATGGCTAAAGGAGAACGGCACCAACATCAAGA
TCAAGTTCCCGGGTGAGGACGAACTGGACCACACCTGGTAGAAGGTTTTA
CCTTAGACCTACATACAGTTTAACTCTTATCTTAAATGTTATACATATGT
TATATACTGGACTTAATTATAGATACCCTTAGGGGGGAACCATATTCTTG
CGACCTCAGGTAGCGTACAGAAGAGAGCCTTACCTTTACTATCTGGGAGG
ATTTGTGTACATTTGGTTACATTAAAACATGATCCGATGGAAAAGGTTCT
CTTGGGTTTCAGGTACAAGCCGGTGAAGTAGGTTATAAAACTGTTCCGAT
GTTGGTTAACCAGTTCTGTTGGCATAACCAGTTTGTTTATATCTCAATAT
ATATATCTCAATAGGTGAATCGTATTATCTTTTCTCTCAACTATTGTGTG
TGTTTAATTAGTCAGCGTGGGCGTCATCAGCGGTGTCAGTGGATGTTACA
AATAATAATTCCCCCTTTCTTGCTGATAATAAGCTTGTTTTTTTTAAATA
ATCAGAAGACCTTTCGAAAACAATAGACATTAGTAATTTATCAGAAACAC
AACTGGCAACTGGTAACTAAACTAAAAGCGTCAGTAAACTCCACCCCCTA
AAGTCATATATTCATTCTTATCAACCTTCATTGAATAATCATTATCTCTC
GAAAAGTAGAAATGAAAACTTTAAACATTTGCTAACGACTGACTCAAATA
AAGGTGTACTCACACAGAATGATTAGTCCATACAATGTTAATGCTCCTGA
CCTGGGCAAACAATTAAAATGATATCACAAAACGACAGGCCTGTGCAAAA
CCAAAGTAAAATATTAACCAATAAACTGAAGATTAAGCAAAAAAAAAAAA
AAAA

RH18694.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:33:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG8066-RA 1239 CG8066-RA 103..1238 2..1137 5680 100 Plus
CG8066.a 1404 CG8066.a 268..1403 2..1137 5680 100 Plus
Cys-RA 553 Cys-RA 115..417 45..344 875 86.4 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:22:36
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 10392367..10393355 1137..149 4945 100 Minus
chr3R 27901430 chr3R 10393419..10393566 149..2 740 100 Minus
chr3R 27901430 chr3R 10393923..10394121 344..149 555 86.4 Minus
chr3R 27901430 chr3R 10394179..10394283 149..45 315 86.7 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:23:56 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:22:34
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 14567601..14568599 1147..149 4980 99.9 Minus
3R 32079331 3R 14568663..14568810 149..2 740 100 Minus
3R 32079331 3R 14569167..14569365 344..149 555 86.4 Minus
3R 32079331 3R 14569423..14569527 149..45 315 86.7 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:08:47
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 14308432..14309430 1147..149 4980 99.8 Minus
3R 31820162 3R 14309494..14309641 149..2 740 100 Minus
3R 31820162 3R 14309998..14310196 344..149 565 86.4 Minus
3R 31820162 3R 14310254..14310358 149..45 315 86.6 Minus
Blast to na_te.dros performed on 2019-03-16 14:22:34 has no hits.

RH18694.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:23:40 Download gff for RH18694.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 10392366..10393355 149..1138 99 <- Minus
chr3R 10393420..10393566 1..148 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:42:48 Download gff for RH18694.complete
Subject Subject Range Query Range Percent Splice Strand
CG8066-RA 1..315 27..341 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:04:48 Download gff for RH18694.complete
Subject Subject Range Query Range Percent Splice Strand
CG8066-RA 1..315 27..341 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:45:56 Download gff for RH18694.complete
Subject Subject Range Query Range Percent Splice Strand
CG8066-RA 1..315 27..341 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:55:00 Download gff for RH18694.complete
Subject Subject Range Query Range Percent Splice Strand
CG8066-RA 1..315 27..341 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:26:53 Download gff for RH18694.complete
Subject Subject Range Query Range Percent Splice Strand
CG8066-RA 1..315 27..341 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:24:10 Download gff for RH18694.complete
Subject Subject Range Query Range Percent Splice Strand
CG8066-RA 1..1136 2..1138 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:04:48 Download gff for RH18694.complete
Subject Subject Range Query Range Percent Splice Strand
CG8066-RA 1..1136 2..1138 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:45:56 Download gff for RH18694.complete
Subject Subject Range Query Range Percent Splice Strand
CG8066-RA 37..1173 1..1137 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:55:00 Download gff for RH18694.complete
Subject Subject Range Query Range Percent Splice Strand
CG8066-RA 1..1136 2..1138 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:26:53 Download gff for RH18694.complete
Subject Subject Range Query Range Percent Splice Strand
CG8066-RA 37..1173 1..1137 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:23:40 Download gff for RH18694.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14567610..14568599 149..1138 99 <- Minus
3R 14568664..14568810 1..148 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:23:40 Download gff for RH18694.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14567610..14568599 149..1138 99 <- Minus
3R 14568664..14568810 1..148 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:23:40 Download gff for RH18694.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14567610..14568599 149..1138 99 <- Minus
3R 14568664..14568810 1..148 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:45:56 Download gff for RH18694.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 10393332..10394321 149..1138 99 <- Minus
arm_3R 10394386..10394532 1..148 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:27:20 Download gff for RH18694.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14308441..14309430 149..1138 99 <- Minus
3R 14309495..14309641 1..148 99   Minus

RH18694.hyp Sequence

Translation from 2 to 340

> RH18694.hyp
LSFATIAAMSNVPIVGGISQLEGNERKEALELLDATLAQLANGDGPSYKA
LNVTSVTGQVVAGRLNTYEVQLDNGSEIKQGTVQIWSRAWLKENGTNIKI
KFPGEDELDHTW*

RH18694.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:30:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG8066-PB 104 CG8066-PB 1..104 9..112 538 100 Plus
CG8066-PA 104 CG8066-PA 1..104 9..112 538 100 Plus
Cys-PA 126 CG8050-PA 27..126 14..112 414 81 Plus
CG31313-PB 124 CG31313-PB 10..124 1..112 252 46.1 Plus
CG31313-PA 124 CG31313-PA 10..124 1..112 252 46.1 Plus

RH18694.pep Sequence

Translation from 26 to 340

> RH18694.pep
MSNVPIVGGISQLEGNERKEALELLDATLAQLANGDGPSYKALNVTSVTG
QVVAGRLNTYEVQLDNGSEIKQGTVQIWSRAWLKENGTNIKIKFPGEDEL
DHTW*

RH18694.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:28:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17474-PA 94 GF17474-PA 1..94 1..104 290 60.6 Plus
Dana\GF17475-PA 119 GF17475-PA 18..119 3..104 244 48 Plus
Dana\GF17473-PA 134 GF17473-PA 25..124 5..104 217 41 Plus
Dana\GF15461-PA 125 GF15461-PA 27..119 8..100 160 39.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:28:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21219-PA 105 GG21219-PA 1..105 1..104 434 84.8 Plus
Dere\GG21208-PA 126 GG21208-PA 27..126 6..104 410 80 Plus
Dere\GG21229-PA 124 GG21229-PA 26..124 8..104 251 49.5 Plus
Dere\GG18301-PA 122 GG18301-PA 24..116 8..100 166 41.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:28:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14129-PA 122 GH14129-PA 23..122 6..104 264 53 Plus
Dgri\GH14128-PA 107 GH14128-PA 5..102 3..100 224 52 Plus
Dgri\GH14130-PA 132 GH14130-PA 32..132 8..104 215 48.5 Plus
Dgri\GH14131-PA 120 GH14131-PA 22..119 6..103 155 38.4 Plus
Dgri\GH17753-PA 124 GH17753-PA 32..119 13..100 147 38.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:22:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG8066-PB 104 CG8066-PB 1..104 1..104 538 100 Plus
CG8066-PA 104 CG8066-PA 1..104 1..104 538 100 Plus
Cys-PA 126 CG8050-PA 27..126 6..104 414 81 Plus
CG31313-PB 124 CG31313-PB 26..124 8..104 251 49.5 Plus
CG31313-PA 124 CG31313-PA 26..124 8..104 251 49.5 Plus
CG15369-PB 122 CG15369-PB 23..116 7..100 170 41.1 Plus
CG15369-PA 122 CG15369-PA 23..116 7..100 170 41.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:28:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10658-PA 109 GI10658-PA 5..104 3..100 226 50 Plus
Dmoj\GI10659-PA 124 GI10659-PA 27..124 8..104 218 49 Plus
Dmoj\GI10664-PA 116 GI10664-PA 18..106 6..95 190 45.6 Plus
Dmoj\GI10660-PA 119 GI10660-PA 21..109 6..95 189 44.4 Plus
Dmoj\GI10663-PA 119 GI10663-PA 23..109 8..95 184 44.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:28:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24171-PA 127 GL24171-PA 27..127 5..104 345 67.3 Plus
Dper\GL24172-PA 122 GL24172-PA 28..122 13..104 257 56.8 Plus
Dper\GL26833-PA 137 GL26833-PA 31..126 5..97 150 42.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:28:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20790-PA 127 GA20790-PA 27..127 5..104 349 67.3 Plus
Dpse\GA26524-PA 122 GA26524-PA 28..122 13..104 260 56.8 Plus
Dpse\GA13677-PA 137 GA13677-PA 31..126 5..97 155 42.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:28:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25842-PA 105 GM25842-PA 1..105 1..104 481 91.4 Plus
Dsec\GM26670-PA 105 GM26670-PA 1..105 1..104 445 84.8 Plus
Dsec\GM25841-PA 123 GM25841-PA 24..123 6..104 399 78 Plus
Dsec\GM26669-PA 123 GM26669-PA 24..123 6..104 386 76 Plus
Dsec\GM25833-PA 124 GM25833-PA 26..124 8..104 239 48.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:28:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20413-PA 105 GD20413-PA 1..105 1..104 477 90.5 Plus
Dsim\GD20412-PA 123 GD20412-PA 24..123 6..104 391 76 Plus
Dsim\GD20414-PA 124 GD20414-PA 26..124 8..104 243 48.5 Plus
Dsim\GD16941-PA 122 GD16941-PA 24..116 8..100 164 42.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:28:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23017-PA 126 GJ23017-PA 26..126 5..104 273 55.4 Plus
Dvir\GJ23015-PA 110 GJ23015-PA 6..103 3..98 240 49 Plus
Dvir\GJ19267-PA 122 GJ19267-PA 22..116 6..100 166 38.5 Plus
Dvir\GJ23016-PA 165 GJ23016-PA 42..114 21..92 132 44.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:28:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11350-PA 124 GK11350-PA 21..124 3..104 353 67.3 Plus
Dwil\GK11742-PA 128 GK11742-PA 30..128 8..104 269 55.6 Plus
Dwil\GK11349-PA 106 GK11349-PA 7..100 6..99 258 55.3 Plus
Dwil\GK11352-PA 120 GK11352-PA 20..115 3..100 221 50.5 Plus
Dwil\GK25384-PA 129 GK25384-PA 26..122 7..103 164 39.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:28:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26441-PA 105 GE26441-PA 1..105 1..104 444 84.8 Plus
Dyak\Cys-PA 123 GE26440-PA 24..123 6..104 379 74 Plus
Dyak\GE26442-PA 124 GE26442-PA 26..124 8..104 244 48.5 Plus