Clone RH18819 Report

Search the DGRC for RH18819

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:188
Well:19
Vector:pFlc-1
Associated Gene/TranscriptmRpL14-RA
Protein status:RH18819.pep: gold
Preliminary Size:486
Sequenced Size:656

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14048 2002-01-01 Sim4 clustering to Release 2
CG14048 2002-11-12 Blastp of sequenced clone
CG14048 2003-01-01 Sim4 clustering to Release 3
mRpL14 2008-04-29 Release 5.5 accounting
mRpL14 2008-08-15 Release 5.9 accounting
mRpL14 2008-12-18 5.12 accounting

Clone Sequence Records

RH18819.complete Sequence

656 bp (656 high quality bases) assembled on 2002-11-12

GenBank Submission: AY075539

> RH18819.complete
TTTCGTACGATTAAAAGGAATTGTATAATTTATTTTTGTTGTGCGTTTCC
CTTGAGTTTAATGAATTAAATAAAATAGGAACTACAATAATACCTGCGAA
TAATGGCGCTGCGCATCCTGAAAACAGTTAGACAAGTGGCCCAACCACTG
GCGGTAACCCTGGGCGGCCAGCAAACACAGCAATTGATTCACACAACGCC
GGCGTGCTGCGAAATCCGGAAATTGGCCCGGTTACGGGTGGTGGACAACA
GCGATTTGGGAAAGAAAGCGATGGCCGAGGGGCGACCACCGAGGTGCATC
CATGTCTACAACAAACGCGGAGTCGGCTTCATTGGCGATAAGGTGCTGGT
GGCCATCAAGGGACAGATGAAGAAGGGCATTCTCGTGGGACTCAAGCAGA
ACCAGAAGCCCAAACAGCCGAAATTCGATAGCAACAACCTGGTGCTCATC
GACGACAATGGCAGTCCGCTGGGCACTCGCATCCATGTGCCCATTCCCAC
GATCCTGCGAACCATCCTCAAGGAGAAGACGCTGGCCAAAGGAGCCGATT
ACACCAAGGTTCTGGCCATCGCCAGCAGATATGTTTAGGATCCTCCGGAT
CACGCCTTTCTGTTGCTAAATGAATAAAGTTTATCCAACCAAAAAAAAAA
AAAAAA

RH18819.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:33:43
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL14-RA 643 mRpL14-RA 3..639 3..639 3185 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:28:23
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 2237928..2238564 639..3 3155 99.7 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:23:59 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:28:21
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 2343999..2344635 639..3 3185 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:05:03
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 2352097..2352733 639..3 3185 100 Minus
Blast to na_te.dros performed on 2019-03-16 15:28:22 has no hits.

RH18819.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:29:02 Download gff for RH18819.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 2237927..2238566 1..640 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:42:50 Download gff for RH18819.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL14-RA 1..486 103..588 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:59:13 Download gff for RH18819.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL14-RA 1..486 103..588 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:11:37 Download gff for RH18819.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL14-RA 1..486 103..588 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:55:01 Download gff for RH18819.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL14-RA 1..486 103..588 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:42:46 Download gff for RH18819.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL14-RA 1..486 103..588 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:24:12 Download gff for RH18819.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL14-RA 1..639 2..640 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:59:13 Download gff for RH18819.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL14-RA 1..639 2..640 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:11:37 Download gff for RH18819.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL14-RA 13..651 1..640 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:55:01 Download gff for RH18819.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL14-RA 1..639 2..640 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:42:46 Download gff for RH18819.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL14-RA 13..651 1..640 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:29:02 Download gff for RH18819.complete
Subject Subject Range Query Range Percent Splice Strand
X 2343998..2344637 1..640 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:29:02 Download gff for RH18819.complete
Subject Subject Range Query Range Percent Splice Strand
X 2343998..2344637 1..640 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:29:02 Download gff for RH18819.complete
Subject Subject Range Query Range Percent Splice Strand
X 2343998..2344637 1..640 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:11:37 Download gff for RH18819.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 2238031..2238670 1..640 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:21:31 Download gff for RH18819.complete
Subject Subject Range Query Range Percent Splice Strand
X 2352096..2352735 1..640 99   Minus

RH18819.pep Sequence

Translation from 102 to 587

> RH18819.pep
MALRILKTVRQVAQPLAVTLGGQQTQQLIHTTPACCEIRKLARLRVVDNS
DLGKKAMAEGRPPRCIHVYNKRGVGFIGDKVLVAIKGQMKKGILVGLKQN
QKPKQPKFDSNNLVLIDDNGSPLGTRIHVPIPTILRTILKEKTLAKGADY
TKVLAIASRYV*

RH18819.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:39:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21957-PA 158 GF21957-PA 26..158 29..161 625 97.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:39:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12621-PA 161 GG12621-PA 1..161 1..161 809 96.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:39:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12815-PA 173 GH12815-PA 18..173 6..161 688 85.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:31:38
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL14-PB 161 CG14048-PB 1..161 1..161 817 100 Plus
mRpL14-PA 161 CG14048-PA 1..161 1..161 817 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:39:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15919-PA 171 GI15919-PA 39..171 29..161 662 94 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:39:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26911-PA 165 GL26911-PA 1..165 1..161 704 83 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:39:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12726-PA 165 GA12726-PA 1..165 1..161 712 83.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:39:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18887-PA 161 GM18887-PA 1..161 1..161 820 98.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:39:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16369-PA 897 GD16369-PA 822..897 86..161 385 97.4 Plus
Dsim\GD24612-PA 78 GD24612-PA 1..62 1..67 265 85.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:39:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16826-PA 172 GJ16826-PA 25..172 14..161 680 86.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:39:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25783-PA 162 GK25783-PA 15..162 14..161 683 87.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:39:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16952-PA 161 GE16952-PA 1..161 1..161 793 95 Plus

RH18819.hyp Sequence

Translation from 102 to 587

> RH18819.hyp
MALRILKTVRQVAQPLAVTLGGQQTQQLIHTTPACCEIRKLARLRVVDNS
DLGKKAMAEGRPPRCIHVYNKRGVGFIGDKVLVAIKGQMKKGILVGLKQN
QKPKQPKFDSNNLVLIDDNGSPLGTRIHVPIPTILRTILKEKTLAKGADY
TKVLAIASRYV*

RH18819.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:03:02
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL14-PB 161 CG14048-PB 1..161 1..161 817 100 Plus
mRpL14-PA 161 CG14048-PA 1..161 1..161 817 100 Plus