BDGP Sequence Production Resources |
Search the DGRC for RH18819
Library: | RH |
Tissue Source: | Drosophila melanogaster adult head |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2001-04-30 |
Comments: | Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 188 |
Well: | 19 |
Vector: | pFlc-1 |
Associated Gene/Transcript | mRpL14-RA |
Protein status: | RH18819.pep: gold |
Preliminary Size: | 486 |
Sequenced Size: | 656 |
Gene | Date | Evidence |
---|---|---|
CG14048 | 2002-01-01 | Sim4 clustering to Release 2 |
CG14048 | 2002-11-12 | Blastp of sequenced clone |
CG14048 | 2003-01-01 | Sim4 clustering to Release 3 |
mRpL14 | 2008-04-29 | Release 5.5 accounting |
mRpL14 | 2008-08-15 | Release 5.9 accounting |
mRpL14 | 2008-12-18 | 5.12 accounting |
656 bp (656 high quality bases) assembled on 2002-11-12
GenBank Submission: AY075539
> RH18819.complete TTTCGTACGATTAAAAGGAATTGTATAATTTATTTTTGTTGTGCGTTTCC CTTGAGTTTAATGAATTAAATAAAATAGGAACTACAATAATACCTGCGAA TAATGGCGCTGCGCATCCTGAAAACAGTTAGACAAGTGGCCCAACCACTG GCGGTAACCCTGGGCGGCCAGCAAACACAGCAATTGATTCACACAACGCC GGCGTGCTGCGAAATCCGGAAATTGGCCCGGTTACGGGTGGTGGACAACA GCGATTTGGGAAAGAAAGCGATGGCCGAGGGGCGACCACCGAGGTGCATC CATGTCTACAACAAACGCGGAGTCGGCTTCATTGGCGATAAGGTGCTGGT GGCCATCAAGGGACAGATGAAGAAGGGCATTCTCGTGGGACTCAAGCAGA ACCAGAAGCCCAAACAGCCGAAATTCGATAGCAACAACCTGGTGCTCATC GACGACAATGGCAGTCCGCTGGGCACTCGCATCCATGTGCCCATTCCCAC GATCCTGCGAACCATCCTCAAGGAGAAGACGCTGGCCAAAGGAGCCGATT ACACCAAGGTTCTGGCCATCGCCAGCAGATATGTTTAGGATCCTCCGGAT CACGCCTTTCTGTTGCTAAATGAATAAAGTTTATCCAACCAAAAAAAAAA AAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mRpL14-RA | 643 | mRpL14-RA | 3..639 | 3..639 | 3185 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chrX | 22417052 | chrX | 2237928..2238564 | 639..3 | 3155 | 99.7 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
X | 23542271 | X | 2343999..2344635 | 639..3 | 3185 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
X | 23527363 | X | 2352097..2352733 | 639..3 | 3185 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chrX | 2237927..2238566 | 1..640 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL14-RA | 1..486 | 103..588 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL14-RA | 1..486 | 103..588 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL14-RA | 1..486 | 103..588 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL14-RA | 1..486 | 103..588 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL14-RA | 1..486 | 103..588 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL14-RA | 1..639 | 2..640 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL14-RA | 1..639 | 2..640 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL14-RA | 13..651 | 1..640 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL14-RA | 1..639 | 2..640 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL14-RA | 13..651 | 1..640 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 2343998..2344637 | 1..640 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 2343998..2344637 | 1..640 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 2343998..2344637 | 1..640 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_X | 2238031..2238670 | 1..640 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 2352096..2352735 | 1..640 | 99 | Minus |
Translation from 102 to 587
> RH18819.pep MALRILKTVRQVAQPLAVTLGGQQTQQLIHTTPACCEIRKLARLRVVDNS DLGKKAMAEGRPPRCIHVYNKRGVGFIGDKVLVAIKGQMKKGILVGLKQN QKPKQPKFDSNNLVLIDDNGSPLGTRIHVPIPTILRTILKEKTLAKGADY TKVLAIASRYV*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF21957-PA | 158 | GF21957-PA | 26..158 | 29..161 | 625 | 97.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG12621-PA | 161 | GG12621-PA | 1..161 | 1..161 | 809 | 96.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH12815-PA | 173 | GH12815-PA | 18..173 | 6..161 | 688 | 85.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mRpL14-PB | 161 | CG14048-PB | 1..161 | 1..161 | 817 | 100 | Plus |
mRpL14-PA | 161 | CG14048-PA | 1..161 | 1..161 | 817 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI15919-PA | 171 | GI15919-PA | 39..171 | 29..161 | 662 | 94 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL26911-PA | 165 | GL26911-PA | 1..165 | 1..161 | 704 | 83 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA12726-PA | 165 | GA12726-PA | 1..165 | 1..161 | 712 | 83.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM18887-PA | 161 | GM18887-PA | 1..161 | 1..161 | 820 | 98.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD16369-PA | 897 | GD16369-PA | 822..897 | 86..161 | 385 | 97.4 | Plus |
Dsim\GD24612-PA | 78 | GD24612-PA | 1..62 | 1..67 | 265 | 85.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ16826-PA | 172 | GJ16826-PA | 25..172 | 14..161 | 680 | 86.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK25783-PA | 162 | GK25783-PA | 15..162 | 14..161 | 683 | 87.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE16952-PA | 161 | GE16952-PA | 1..161 | 1..161 | 793 | 95 | Plus |
Translation from 102 to 587
> RH18819.hyp MALRILKTVRQVAQPLAVTLGGQQTQQLIHTTPACCEIRKLARLRVVDNS DLGKKAMAEGRPPRCIHVYNKRGVGFIGDKVLVAIKGQMKKGILVGLKQN QKPKQPKFDSNNLVLIDDNGSPLGTRIHVPIPTILRTILKEKTLAKGADY TKVLAIASRYV*