Clone RH19248 Report

Search the DGRC for RH19248

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:192
Well:48
Vector:pFlc-1
Associated Gene/TranscriptCG11686-RA
Protein status:RH19248.pep: gold
Preliminary Size:358
Sequenced Size:442

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11686 2002-01-01 Sim4 clustering to Release 2
CG11686 2003-01-01 Sim4 clustering to Release 3
CG11686 2008-04-29 Release 5.5 accounting
CG11686 2008-08-15 Release 5.9 accounting
CG11686 2008-12-18 5.12 accounting

Clone Sequence Records

RH19248.complete Sequence

442 bp (442 high quality bases) assembled on 2001-12-13

GenBank Submission: AY070684

> RH19248.complete
GTCAGTCTTCATTCCATTCTCGAATCCCCCGGACGTCGACCTCCGATCCG
ATCGTCTACTTGCTGAAATCGCTCTGAACAAACAACACCACTCATCACGA
TGCCAAATCCACTGTGGTTCGTCTTCTGGCTGCTGGTCTTCTGGTTCGTC
TCCTTCTTCGTGGCATTCTTCTGCGCCTTTTTCTACATCTGGGTCTACGC
ATTTGCCTCCTGCATTCCCGCCCTGACGGGCATATCGGACATTCTGCTCC
AGGGAGTCCAGTTCCCGTTCTACTGCGGGAAAGCCATGTTAGAGGGCAAG
CAAGCTTTTTAAGGGGGATATTTCCCCAATATCAATTAACTAAGTGCCTT
ACTGATAACTCTTGTTTTCAATCATTTTTTACAATTTTACAAATAAAGAT
TTATTAACTTATATTTATAAAAAAAAGAAAAAAAAAAAAAAA

RH19248.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:48:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG11686-RA 515 CG11686-RA 39..457 2..420 2095 100 Plus
CG11686.a 457 CG11686.a 96..454 62..420 1795 100 Plus
CG11686.d 583 CG11686.d 167..525 62..420 1795 100 Plus
CG11686.a 457 CG11686.a 9..69 2..62 305 100 Plus
CG11686.d 583 CG11686.d 39..99 2..62 305 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:28:25
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 9087180..9087372 228..420 950 99.5 Plus
chr3R 27901430 chr3R 9086740..9086907 62..229 825 99.4 Plus
chr3R 27901430 chr3R 9085493..9085553 2..62 290 98.4 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:24:04 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:28:24
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 13262037..13262229 228..420 965 100 Plus
3R 32079331 3R 13261604..13261771 62..229 840 100 Plus
3R 32079331 3R 13260358..13260418 2..62 305 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:08:08
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 13002868..13003060 228..420 965 100 Plus
3R 31820162 3R 13002435..13002602 62..229 840 100 Plus
3R 31820162 3R 13001189..13001249 2..62 305 100 Plus
Blast to na_te.dros performed 2019-03-16 15:28:24
Subject Length Description Subject Range Query Range Score Percent Strand
transib4 2656 transib4 TRANSIB4 2656bp 2578..2626 420..374 114 73.5 Minus
Transpac 5249 Transpac 5249bp Derived from AF222049 (AF222049.1) (Rel. 62, Last updated, Version 1). 3774..3851 427..349 113 63.7 Minus

RH19248.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:29:04 Download gff for RH19248.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 9087181..9087322 229..370 99 -> Plus
chr3R 9085492..9085553 1..62 96 -> Plus
chr3R 9086741..9086906 63..228 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:42:55 Download gff for RH19248.complete
Subject Subject Range Query Range Percent Splice Strand
CG11686-RA 1..213 100..312 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:42:48 Download gff for RH19248.complete
Subject Subject Range Query Range Percent Splice Strand
CG11686-RA 1..213 100..312 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:11:44 Download gff for RH19248.complete
Subject Subject Range Query Range Percent Splice Strand
CG11686-RA 1..213 100..312 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:21:47 Download gff for RH19248.complete
Subject Subject Range Query Range Percent Splice Strand
CG11686-RA 1..213 100..312 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:42:52 Download gff for RH19248.complete
Subject Subject Range Query Range Percent Splice Strand
CG11686-RA 1..213 100..312 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:50:04 Download gff for RH19248.complete
Subject Subject Range Query Range Percent Splice Strand
CG11686-RA 2..419 2..419 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:42:48 Download gff for RH19248.complete
Subject Subject Range Query Range Percent Splice Strand
CG11686-RA 2..418 2..418 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:11:44 Download gff for RH19248.complete
Subject Subject Range Query Range Percent Splice Strand
CG11686-RA 2..419 1..418 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:21:47 Download gff for RH19248.complete
Subject Subject Range Query Range Percent Splice Strand
CG11686-RA 2..423 2..423 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:42:52 Download gff for RH19248.complete
Subject Subject Range Query Range Percent Splice Strand
CG11686-RA 2..419 1..418 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:29:04 Download gff for RH19248.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13260357..13260418 1..62 98 -> Plus
3R 13261605..13261770 63..228 100 -> Plus
3R 13262038..13262229 229..420 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:29:04 Download gff for RH19248.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13260357..13260418 1..62 98 -> Plus
3R 13261605..13261770 63..228 100 -> Plus
3R 13262038..13262229 229..420 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:29:04 Download gff for RH19248.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13260357..13260418 1..62 98 -> Plus
3R 13261605..13261770 63..228 100 -> Plus
3R 13262038..13262229 229..420 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:11:44 Download gff for RH19248.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 9086079..9086140 1..62 98 -> Plus
arm_3R 9087327..9087492 63..228 100 -> Plus
arm_3R 9087760..9087951 229..420 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:56:24 Download gff for RH19248.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13002436..13002601 63..228 100 -> Plus
3R 13001188..13001249 1..62 98 -> Plus
3R 13002869..13003060 229..420 100   Plus

RH19248.hyp Sequence

Translation from 0 to 225

> RH19248.hyp
SVFIPFSNPPDVDLRSDRLLAEIALNKQHHSSRCQIHCGSSSGCWSSGSS
PSSWHSSAPFSTSGSTHLPPAFPP*
Sequence RH19248.hyp has no blast hits.

RH19248.pep Sequence

Translation from 99 to 311

> RH19248.pep
MPNPLWFVFWLLVFWFVSFFVAFFCAFFYIWVYAFASCIPALTGISDILL
QGVQFPFYCGKAMLEGKQAF*

RH19248.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:26:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17586-PA 70 GF17586-PA 1..70 1..70 289 94.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:26:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19511-PA 70 GG19511-PA 1..70 1..70 347 98.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:26:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18383-PA 70 GH18383-PA 1..68 1..68 244 66.2 Plus
Dgri\GH12209-PA 70 GH12209-PA 1..68 1..68 164 50 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:45:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG11686-PB 70 CG11686-PB 1..70 1..70 393 100 Plus
CG11686-PA 70 CG11686-PA 1..70 1..70 393 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:26:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23375-PA 70 GI23375-PA 1..70 1..70 219 58.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:26:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24398-PA 70 GL24398-PA 1..70 1..70 268 91.4 Plus
Dper\GL21042-PA 70 GL21042-PA 1..68 1..68 137 52.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:26:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11142-PA 70 GA11142-PA 1..70 1..70 266 91.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:26:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24092-PA 70 GM24092-PA 1..70 1..70 348 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:26:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18891-PA 70 GD18891-PA 1..70 1..70 348 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:26:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10369-PA 70 GJ10369-PA 1..70 1..70 245 65.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:26:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22412-PA 70 GK22412-PA 1..70 1..70 272 92.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:26:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26255-PA 70 GE26255-PA 1..70 1..70 281 94.3 Plus