BDGP Sequence Production Resources |
Search the DGRC for RH19248
Library: | RH |
Tissue Source: | Drosophila melanogaster adult head |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2001-04-30 |
Comments: | Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 192 |
Well: | 48 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG11686-RA |
Protein status: | RH19248.pep: gold |
Preliminary Size: | 358 |
Sequenced Size: | 442 |
Gene | Date | Evidence |
---|---|---|
CG11686 | 2002-01-01 | Sim4 clustering to Release 2 |
CG11686 | 2003-01-01 | Sim4 clustering to Release 3 |
CG11686 | 2008-04-29 | Release 5.5 accounting |
CG11686 | 2008-08-15 | Release 5.9 accounting |
CG11686 | 2008-12-18 | 5.12 accounting |
442 bp (442 high quality bases) assembled on 2001-12-13
GenBank Submission: AY070684
> RH19248.complete GTCAGTCTTCATTCCATTCTCGAATCCCCCGGACGTCGACCTCCGATCCG ATCGTCTACTTGCTGAAATCGCTCTGAACAAACAACACCACTCATCACGA TGCCAAATCCACTGTGGTTCGTCTTCTGGCTGCTGGTCTTCTGGTTCGTC TCCTTCTTCGTGGCATTCTTCTGCGCCTTTTTCTACATCTGGGTCTACGC ATTTGCCTCCTGCATTCCCGCCCTGACGGGCATATCGGACATTCTGCTCC AGGGAGTCCAGTTCCCGTTCTACTGCGGGAAAGCCATGTTAGAGGGCAAG CAAGCTTTTTAAGGGGGATATTTCCCCAATATCAATTAACTAAGTGCCTT ACTGATAACTCTTGTTTTCAATCATTTTTTACAATTTTACAAATAAAGAT TTATTAACTTATATTTATAAAAAAAAGAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG11686-RA | 515 | CG11686-RA | 39..457 | 2..420 | 2095 | 100 | Plus |
CG11686.a | 457 | CG11686.a | 96..454 | 62..420 | 1795 | 100 | Plus |
CG11686.d | 583 | CG11686.d | 167..525 | 62..420 | 1795 | 100 | Plus |
CG11686.a | 457 | CG11686.a | 9..69 | 2..62 | 305 | 100 | Plus |
CG11686.d | 583 | CG11686.d | 39..99 | 2..62 | 305 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 9087180..9087372 | 228..420 | 950 | 99.5 | Plus |
chr3R | 27901430 | chr3R | 9086740..9086907 | 62..229 | 825 | 99.4 | Plus |
chr3R | 27901430 | chr3R | 9085493..9085553 | 2..62 | 290 | 98.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
transib4 | 2656 | transib4 TRANSIB4 2656bp | 2578..2626 | 420..374 | 114 | 73.5 | Minus |
Transpac | 5249 | Transpac 5249bp Derived from AF222049 (AF222049.1) (Rel. 62, Last updated, Version 1). | 3774..3851 | 427..349 | 113 | 63.7 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 9087181..9087322 | 229..370 | 99 | -> | Plus |
chr3R | 9085492..9085553 | 1..62 | 96 | -> | Plus |
chr3R | 9086741..9086906 | 63..228 | 99 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11686-RA | 1..213 | 100..312 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11686-RA | 1..213 | 100..312 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11686-RA | 1..213 | 100..312 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11686-RA | 1..213 | 100..312 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11686-RA | 1..213 | 100..312 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11686-RA | 2..419 | 2..419 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11686-RA | 2..418 | 2..418 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11686-RA | 2..419 | 1..418 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11686-RA | 2..423 | 2..423 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11686-RA | 2..419 | 1..418 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 13260357..13260418 | 1..62 | 98 | -> | Plus |
3R | 13261605..13261770 | 63..228 | 100 | -> | Plus |
3R | 13262038..13262229 | 229..420 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 13260357..13260418 | 1..62 | 98 | -> | Plus |
3R | 13261605..13261770 | 63..228 | 100 | -> | Plus |
3R | 13262038..13262229 | 229..420 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 13260357..13260418 | 1..62 | 98 | -> | Plus |
3R | 13261605..13261770 | 63..228 | 100 | -> | Plus |
3R | 13262038..13262229 | 229..420 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 9086079..9086140 | 1..62 | 98 | -> | Plus |
arm_3R | 9087327..9087492 | 63..228 | 100 | -> | Plus |
arm_3R | 9087760..9087951 | 229..420 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 13002436..13002601 | 63..228 | 100 | -> | Plus |
3R | 13001188..13001249 | 1..62 | 98 | -> | Plus |
3R | 13002869..13003060 | 229..420 | 100 | Plus |
Translation from 0 to 225
> RH19248.hyp SVFIPFSNPPDVDLRSDRLLAEIALNKQHHSSRCQIHCGSSSGCWSSGSS PSSWHSSAPFSTSGSTHLPPAFPP*
Translation from 99 to 311
> RH19248.pep MPNPLWFVFWLLVFWFVSFFVAFFCAFFYIWVYAFASCIPALTGISDILL QGVQFPFYCGKAMLEGKQAF*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF17586-PA | 70 | GF17586-PA | 1..70 | 1..70 | 289 | 94.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG19511-PA | 70 | GG19511-PA | 1..70 | 1..70 | 347 | 98.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH18383-PA | 70 | GH18383-PA | 1..68 | 1..68 | 244 | 66.2 | Plus |
Dgri\GH12209-PA | 70 | GH12209-PA | 1..68 | 1..68 | 164 | 50 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG11686-PB | 70 | CG11686-PB | 1..70 | 1..70 | 393 | 100 | Plus |
CG11686-PA | 70 | CG11686-PA | 1..70 | 1..70 | 393 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI23375-PA | 70 | GI23375-PA | 1..70 | 1..70 | 219 | 58.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL24398-PA | 70 | GL24398-PA | 1..70 | 1..70 | 268 | 91.4 | Plus |
Dper\GL21042-PA | 70 | GL21042-PA | 1..68 | 1..68 | 137 | 52.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA11142-PA | 70 | GA11142-PA | 1..70 | 1..70 | 266 | 91.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM24092-PA | 70 | GM24092-PA | 1..70 | 1..70 | 348 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD18891-PA | 70 | GD18891-PA | 1..70 | 1..70 | 348 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ10369-PA | 70 | GJ10369-PA | 1..70 | 1..70 | 245 | 65.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK22412-PA | 70 | GK22412-PA | 1..70 | 1..70 | 272 | 92.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE26255-PA | 70 | GE26255-PA | 1..70 | 1..70 | 281 | 94.3 | Plus |