Clone RH19272 Report

Search the DGRC for RH19272

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:192
Well:72
Vector:pFlc-1
Associated Gene/TranscriptCG31777-RA
Protein status:RH19272.pep: validated not full length
Sequenced Size:395

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG31777 2003-01-01 Sim4 clustering to Release 3
CG31777 2004-01-31 Blastp of sequenced clone
CG31777 2008-04-29 Release 5.5 accounting
CG31777 2008-08-15 Release 5.9 accounting
CG31777 2008-12-18 5.12 accounting

Clone Sequence Records

RH19272.complete Sequence

395 bp (395 high quality bases) assembled on 2004-01-31

GenBank Submission: BT011523

> RH19272.complete
GAGTTGCCCGCCGCCAGTCCAGATCTCGACACAAGCCCGCGTCGGTGGTG
CTAACGCTGCTGTTGGTGGTGCTGTTGGCGCTGATCCACCACCGCCGCAT
AGATGCCAGATTCGTGCCCGGTCCGCCTTCAATACCCAGTATTTGCAAAA
AACCACCGCCACGTTCGGAGGGCGTTTGTGCCATTGATATCGAGGGATAC
TATTACGATCCGATAACATTTGACTGCAAGATGTACAAGATCGGGGCATG
CCACTTGATTCGTGGCCAGAGTTTCGGCAGTCAACAGGATTGCATTTCCA
CCTGCATCCATGGGATACGCCGGAATCATGACTTTTATGTGAACGAGTAA
TATAAATAAATACGTAAACAAATGTACCCAAAAAAAAAAAAAAAA

RH19272.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:04:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG31777-RA 595 CG31777-RA 140..520 2..380 1850 99.4 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:22:48
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 3706065..3706305 379..139 1190 99.6 Minus
chr2L 23010047 chr2L 3706434..3706574 140..2 640 98.6 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:24:06 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:22:46
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3706550..3706791 380..139 1210 100 Minus
2L 23513712 2L 3706920..3707060 140..2 640 98.6 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:59:23
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3706550..3706791 380..139 1210 100 Minus
2L 23513712 2L 3706920..3707060 140..2 650 98.5 Minus
Blast to na_te.dros performed 2019-03-16 14:22:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6847..6893 87..41 127 74.5 Minus

RH19272.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:23:46 Download gff for RH19272.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 3706065..3706305 139..379 99 <- Minus
chr2L 3706436..3706574 1..138 97   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:42:56 Download gff for RH19272.complete
Subject Subject Range Query Range Percent Splice Strand
CG31777-RA 1..330 23..350 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:03:44 Download gff for RH19272.complete
Subject Subject Range Query Range Percent Splice Strand
CG31777-RA 1..330 23..350 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:46:32 Download gff for RH19272.complete
Subject Subject Range Query Range Percent Splice Strand
CG31777-RA 1..330 23..350 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:04:23 Download gff for RH19272.complete
Subject Subject Range Query Range Percent Splice Strand
CG31777-RA 1..330 23..350 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:26:58 Download gff for RH19272.complete
Subject Subject Range Query Range Percent Splice Strand
CG31777-RA 1..330 23..350 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:29:26 Download gff for RH19272.complete
Subject Subject Range Query Range Percent Splice Strand
CG31777-RA 1..380 2..379 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:03:43 Download gff for RH19272.complete
Subject Subject Range Query Range Percent Splice Strand
CG31777-RA 1..380 2..379 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:46:32 Download gff for RH19272.complete
Subject Subject Range Query Range Percent Splice Strand
CG31777-RA 3..383 1..379 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:04:24 Download gff for RH19272.complete
Subject Subject Range Query Range Percent Splice Strand
CG31777-RA 1..380 2..379 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:26:58 Download gff for RH19272.complete
Subject Subject Range Query Range Percent Splice Strand
CG31777-RA 3..383 1..379 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:23:46 Download gff for RH19272.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3706922..3707060 1..138 97   Minus
2L 3706551..3706791 139..379 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:23:46 Download gff for RH19272.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3706922..3707060 1..138 97   Minus
2L 3706551..3706791 139..379 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:23:46 Download gff for RH19272.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3706922..3707060 1..138 97   Minus
2L 3706551..3706791 139..379 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:46:32 Download gff for RH19272.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 3706551..3706791 139..379 100 <- Minus
arm_2L 3706922..3707060 1..138 97   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:37:57 Download gff for RH19272.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3706551..3706791 139..379 100 <- Minus
2L 3706922..3707060 1..138 97   Minus

RH19272.hyp Sequence

Translation from 0 to 349

> RH19272.hyp
SCPPPVQMSRHKPASVVLTLLLVVLLALIHHRRIDARFVPGPPSIPSICK
KPPPRSEGVCAIDIEGYYYDPITFDCKMYKIGACHLIRGQSFGSQQDCIS
TCIHGIRRNHDFYVNE*

RH19272.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:25:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG31777-PA 109 CG31777-PA 1..109 8..116 594 100 Plus

RH19272.pep Sequence

Translation from 2 to 349

> RH19272.pep
VARRQSRSRHKPASVVLTLLLVVLLALIHHRRIDARFVPGPPSIPSICKK
PPPRSEGVCAIDIEGYYYDPITFDCKMYKIGACHLIRGQSFGSQQDCIST
CIHGIRRNHDFYVNE*

RH19272.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 07:26:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14650-PA 110 GF14650-PA 24..110 29..115 273 58.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 07:26:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24405-PA 109 GG24405-PA 3..109 9..115 550 96.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 07:26:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13175-PA 102 GH13175-PA 22..102 32..115 267 59.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:28:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG31777-PA 109 CG31777-PA 2..109 8..115 589 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 07:26:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17753-PA 100 GI17753-PA 20..100 32..115 290 61.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 07:26:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19455-PA 112 GL19455-PA 28..111 33..115 322 67.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 07:26:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16468-PA 108 GA16468-PA 24..107 33..115 321 67.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 07:26:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18122-PA 109 GM18122-PA 2..109 8..115 560 97.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 07:26:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22730-PA 109 GD22730-PA 2..109 8..115 484 95.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 07:26:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17581-PA 100 GJ17581-PA 21..100 33..115 287 63.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 07:26:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15464-PA 102 GK15464-PA 21..102 34..115 315 63.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 07:26:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14806-PA 110 GE14806-PA 3..110 9..115 462 92.6 Plus