BDGP Sequence Production Resources |
Search the DGRC for RH19272
Library: | RH |
Tissue Source: | Drosophila melanogaster adult head |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2001-04-30 |
Comments: | Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 192 |
Well: | 72 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG31777-RA |
Protein status: | RH19272.pep: validated not full length |
Sequenced Size: | 395 |
Gene | Date | Evidence |
---|---|---|
CG31777 | 2003-01-01 | Sim4 clustering to Release 3 |
CG31777 | 2004-01-31 | Blastp of sequenced clone |
CG31777 | 2008-04-29 | Release 5.5 accounting |
CG31777 | 2008-08-15 | Release 5.9 accounting |
CG31777 | 2008-12-18 | 5.12 accounting |
395 bp (395 high quality bases) assembled on 2004-01-31
GenBank Submission: BT011523
> RH19272.complete GAGTTGCCCGCCGCCAGTCCAGATCTCGACACAAGCCCGCGTCGGTGGTG CTAACGCTGCTGTTGGTGGTGCTGTTGGCGCTGATCCACCACCGCCGCAT AGATGCCAGATTCGTGCCCGGTCCGCCTTCAATACCCAGTATTTGCAAAA AACCACCGCCACGTTCGGAGGGCGTTTGTGCCATTGATATCGAGGGATAC TATTACGATCCGATAACATTTGACTGCAAGATGTACAAGATCGGGGCATG CCACTTGATTCGTGGCCAGAGTTTCGGCAGTCAACAGGATTGCATTTCCA CCTGCATCCATGGGATACGCCGGAATCATGACTTTTATGTGAACGAGTAA TATAAATAAATACGTAAACAAATGTACCCAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG31777-RA | 595 | CG31777-RA | 140..520 | 2..380 | 1850 | 99.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6847..6893 | 87..41 | 127 | 74.5 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 3706065..3706305 | 139..379 | 99 | <- | Minus |
chr2L | 3706436..3706574 | 1..138 | 97 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31777-RA | 1..330 | 23..350 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31777-RA | 1..330 | 23..350 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31777-RA | 1..330 | 23..350 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31777-RA | 1..330 | 23..350 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31777-RA | 1..330 | 23..350 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31777-RA | 1..380 | 2..379 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31777-RA | 1..380 | 2..379 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31777-RA | 3..383 | 1..379 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31777-RA | 1..380 | 2..379 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31777-RA | 3..383 | 1..379 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 3706922..3707060 | 1..138 | 97 | Minus | |
2L | 3706551..3706791 | 139..379 | 100 | <- | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 3706922..3707060 | 1..138 | 97 | Minus | |
2L | 3706551..3706791 | 139..379 | 100 | <- | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 3706922..3707060 | 1..138 | 97 | Minus | |
2L | 3706551..3706791 | 139..379 | 100 | <- | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 3706551..3706791 | 139..379 | 100 | <- | Minus |
arm_2L | 3706922..3707060 | 1..138 | 97 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 3706551..3706791 | 139..379 | 100 | <- | Minus |
2L | 3706922..3707060 | 1..138 | 97 | Minus |
Translation from 0 to 349
> RH19272.hyp SCPPPVQMSRHKPASVVLTLLLVVLLALIHHRRIDARFVPGPPSIPSICK KPPPRSEGVCAIDIEGYYYDPITFDCKMYKIGACHLIRGQSFGSQQDCIS TCIHGIRRNHDFYVNE*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG31777-PA | 109 | CG31777-PA | 1..109 | 8..116 | 594 | 100 | Plus |
Translation from 2 to 349
> RH19272.pep VARRQSRSRHKPASVVLTLLLVVLLALIHHRRIDARFVPGPPSIPSICKK PPPRSEGVCAIDIEGYYYDPITFDCKMYKIGACHLIRGQSFGSQQDCIST CIHGIRRNHDFYVNE*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF14650-PA | 110 | GF14650-PA | 24..110 | 29..115 | 273 | 58.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG24405-PA | 109 | GG24405-PA | 3..109 | 9..115 | 550 | 96.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH13175-PA | 102 | GH13175-PA | 22..102 | 32..115 | 267 | 59.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG31777-PA | 109 | CG31777-PA | 2..109 | 8..115 | 589 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI17753-PA | 100 | GI17753-PA | 20..100 | 32..115 | 290 | 61.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL19455-PA | 112 | GL19455-PA | 28..111 | 33..115 | 322 | 67.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA16468-PA | 108 | GA16468-PA | 24..107 | 33..115 | 321 | 67.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM18122-PA | 109 | GM18122-PA | 2..109 | 8..115 | 560 | 97.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD22730-PA | 109 | GD22730-PA | 2..109 | 8..115 | 484 | 95.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ17581-PA | 100 | GJ17581-PA | 21..100 | 33..115 | 287 | 63.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK15464-PA | 102 | GK15464-PA | 21..102 | 34..115 | 315 | 63.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE14806-PA | 110 | GE14806-PA | 3..110 | 9..115 | 462 | 92.6 | Plus |