Clone RH19679 Report

Search the DGRC for RH19679

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:196
Well:79
Vector:pFlc-1
Associated Gene/TranscriptCG7630-RA
Protein status:RH19679.pep: gold
Preliminary Size:408
Sequenced Size:436

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7630 2002-01-01 Sim4 clustering to Release 2
CG7630 2002-04-26 Blastp of sequenced clone
CG7630 2003-01-01 Sim4 clustering to Release 3
CG7630 2008-04-29 Release 5.5 accounting
CG7630 2008-08-15 Release 5.9 accounting
CG7630 2008-12-18 5.12 accounting

Clone Sequence Records

RH19679.complete Sequence

436 bp (436 high quality bases) assembled on 2002-04-26

GenBank Submission: AY113572

> RH19679.complete
GACTGTTCAACACAAGGTAATCTTCGGCTACTTTCGAGCAATCATGTTGG
TTAAGCACATTGTCAAGCAGGGGCTTCTGCTCAAGAACGCTGGCGCTTTG
TCGCGTGCCGCTTACCACGGTGGACATGGTCCCCACTCCACCATGAACGA
TCTGCCCGTGCCCGCTGGAGACTGGAAGGAGCAGCACAGCCAGAAGAACG
CCAAGTACAATGCCGCGCTCATCACTGGCATTCTCGTCCTGGCCGGCACT
ATTGGATTCGTGAAATCTTCTGGTATCATCCACTTCAACTACTACGCGCC
CAAGAGCCTGGACTAAGCCAGCGTTCCCTTACGTGTAAATTAATCCAACA
TTTGTGTTAAATAAGCTTAAAGTGGCGACATAGTAAATCACAGATCCGAA
AGTAAAAAAAAAAAAAAAAGAAAAAAAAAAAAAAAA

RH19679.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:10:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG7630-RA 589 CG7630-RA 141..544 2..405 2020 100 Plus
nc_13185.a 142 nc_13185.a 16..142 89..215 635 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:21:16
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 17415392..17415564 89..261 865 100 Plus
chr3L 24539361 chr3L 17415622..17415767 260..405 730 100 Plus
chr3L 24539361 chr3L 17415061..17415123 27..89 315 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:24:09 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:21:14
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 17425909..17426081 89..261 865 100 Plus
3L 28110227 3L 17426139..17426284 260..405 730 100 Plus
3L 28110227 3L 17425578..17425640 27..89 315 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:41:16
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 17419009..17419181 89..261 865 100 Plus
3L 28103327 3L 17419239..17419384 260..405 730 100 Plus
3L 28103327 3L 17418678..17418740 27..89 315 100 Plus
Blast to na_te.dros performed on 2019-03-15 20:21:14 has no hits.

RH19679.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:21:57 Download gff for RH19679.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 17415622..17415765 260..403 100   Plus
chr3L 17414974..17415000 1..27 96 -> Plus
chr3L 17415062..17415123 28..89 100 -> Plus
chr3L 17415393..17415562 90..259 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:42:59 Download gff for RH19679.complete
Subject Subject Range Query Range Percent Splice Strand
CG7630-RA 1..273 44..316 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:55:03 Download gff for RH19679.complete
Subject Subject Range Query Range Percent Splice Strand
CG7630-RA 1..273 44..316 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 03:06:43 Download gff for RH19679.complete
Subject Subject Range Query Range Percent Splice Strand
CG7630-RA 1..273 44..316 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:47:33 Download gff for RH19679.complete
Subject Subject Range Query Range Percent Splice Strand
CG7630-RA 1..273 44..316 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:34:52 Download gff for RH19679.complete
Subject Subject Range Query Range Percent Splice Strand
CG7630-RA 1..273 44..316 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:34:07 Download gff for RH19679.complete
Subject Subject Range Query Range Percent Splice Strand
CG7630-RA 4..406 1..403 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:55:03 Download gff for RH19679.complete
Subject Subject Range Query Range Percent Splice Strand
CG7630-RA 4..406 1..403 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:06:43 Download gff for RH19679.complete
Subject Subject Range Query Range Percent Splice Strand
CG7630-RA 15..417 1..403 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:47:33 Download gff for RH19679.complete
Subject Subject Range Query Range Percent Splice Strand
CG7630-RA 4..406 1..403 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:34:52 Download gff for RH19679.complete
Subject Subject Range Query Range Percent Splice Strand
CG7630-RA 15..417 1..403 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:21:57 Download gff for RH19679.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17425491..17425517 1..27 96 -> Plus
3L 17425579..17425640 28..89 100 -> Plus
3L 17425910..17426079 90..259 100 -> Plus
3L 17426139..17426282 260..403 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:21:57 Download gff for RH19679.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17425491..17425517 1..27 96 -> Plus
3L 17425579..17425640 28..89 100 -> Plus
3L 17425910..17426079 90..259 100 -> Plus
3L 17426139..17426282 260..403 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:21:57 Download gff for RH19679.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17425491..17425517 1..27 96 -> Plus
3L 17425579..17425640 28..89 100 -> Plus
3L 17425910..17426079 90..259 100 -> Plus
3L 17426139..17426282 260..403 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:06:43 Download gff for RH19679.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 17418591..17418617 1..27 96 -> Plus
arm_3L 17418679..17418740 28..89 100 -> Plus
arm_3L 17419010..17419179 90..259 100 -> Plus
arm_3L 17419239..17419382 260..403 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:20:11 Download gff for RH19679.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17418591..17418617 1..27 96 -> Plus
3L 17418679..17418740 28..89 100 -> Plus
3L 17419010..17419179 90..259 100 -> Plus
3L 17419239..17419382 260..403 100   Plus

RH19679.hyp Sequence

Translation from 0 to 315

> RH19679.hyp
TVQHKVIFGYFRAIMLVKHIVKQGLLLKNAGALSRAAYHGGHGPHSTMND
LPVPAGDWKEQHSQKNAKYNAALITGILVLAGTIGFVKSSGIIHFNYYAP
KSLD*

RH19679.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:11:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG7630-PA 90 CG7630-PA 1..90 15..104 473 100 Plus
gom-PA 305 CG6727-PA 70..136 35..101 149 38.8 Plus

RH19679.pep Sequence

Translation from 43 to 315

> RH19679.pep
MLVKHIVKQGLLLKNAGALSRAAYHGGHGPHSTMNDLPVPAGDWKEQHSQ
KNAKYNAALITGILVLAGTIGFVKSSGIIHFNYYAPKSLD*

RH19679.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:50:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10170-PA 90 GF10170-PA 1..90 1..90 422 88.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:50:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13613-PA 90 GG13613-PA 1..90 1..90 452 94.4 Plus
Dere\GG22166-PA 307 GG22166-PA 69..135 21..87 139 37.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:50:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16589-PA 91 GH16589-PA 1..91 1..90 344 75.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:01:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG7630-PA 90 CG7630-PA 1..90 1..90 473 100 Plus
gom-PA 305 CG6727-PA 70..136 21..87 149 38.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:50:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12436-PA 90 GI12436-PA 1..90 1..90 386 78.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:50:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15579-PA 91 GL15579-PA 1..91 1..90 375 79.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:50:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20492-PA 91 GA20492-PA 1..91 1..90 375 79.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:50:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25696-PA 90 GM25696-PA 1..90 1..90 465 98.9 Plus
Dsec\GM15887-PA 302 GM15887-PA 67..133 21..87 152 40.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:50:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14704-PA 90 GD14704-PA 1..90 1..90 465 98.9 Plus
Dsim\GD11650-PA 302 GD11650-PA 67..133 21..87 148 38.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:50:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12333-PA 91 GJ12333-PA 1..91 1..90 372 78 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:50:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19773-PA 90 GK19773-PA 1..90 1..90 397 82.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:50:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19909-PA 90 GE19909-PA 1..90 1..90 462 98.9 Plus
Dyak\GE14159-PA 307 GE14159-PA 69..135 21..87 147 37.3 Plus