BDGP Sequence Production Resources |
Search the DGRC for RH19679
Library: | RH |
Tissue Source: | Drosophila melanogaster adult head |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2001-04-30 |
Comments: | Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 196 |
Well: | 79 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG7630-RA |
Protein status: | RH19679.pep: gold |
Preliminary Size: | 408 |
Sequenced Size: | 436 |
Gene | Date | Evidence |
---|---|---|
CG7630 | 2002-01-01 | Sim4 clustering to Release 2 |
CG7630 | 2002-04-26 | Blastp of sequenced clone |
CG7630 | 2003-01-01 | Sim4 clustering to Release 3 |
CG7630 | 2008-04-29 | Release 5.5 accounting |
CG7630 | 2008-08-15 | Release 5.9 accounting |
CG7630 | 2008-12-18 | 5.12 accounting |
436 bp (436 high quality bases) assembled on 2002-04-26
GenBank Submission: AY113572
> RH19679.complete GACTGTTCAACACAAGGTAATCTTCGGCTACTTTCGAGCAATCATGTTGG TTAAGCACATTGTCAAGCAGGGGCTTCTGCTCAAGAACGCTGGCGCTTTG TCGCGTGCCGCTTACCACGGTGGACATGGTCCCCACTCCACCATGAACGA TCTGCCCGTGCCCGCTGGAGACTGGAAGGAGCAGCACAGCCAGAAGAACG CCAAGTACAATGCCGCGCTCATCACTGGCATTCTCGTCCTGGCCGGCACT ATTGGATTCGTGAAATCTTCTGGTATCATCCACTTCAACTACTACGCGCC CAAGAGCCTGGACTAAGCCAGCGTTCCCTTACGTGTAAATTAATCCAACA TTTGTGTTAAATAAGCTTAAAGTGGCGACATAGTAAATCACAGATCCGAA AGTAAAAAAAAAAAAAAAAGAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 17415392..17415564 | 89..261 | 865 | 100 | Plus |
chr3L | 24539361 | chr3L | 17415622..17415767 | 260..405 | 730 | 100 | Plus |
chr3L | 24539361 | chr3L | 17415061..17415123 | 27..89 | 315 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 17415622..17415765 | 260..403 | 100 | Plus | |
chr3L | 17414974..17415000 | 1..27 | 96 | -> | Plus |
chr3L | 17415062..17415123 | 28..89 | 100 | -> | Plus |
chr3L | 17415393..17415562 | 90..259 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7630-RA | 1..273 | 44..316 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7630-RA | 1..273 | 44..316 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7630-RA | 1..273 | 44..316 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7630-RA | 1..273 | 44..316 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7630-RA | 1..273 | 44..316 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7630-RA | 4..406 | 1..403 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7630-RA | 4..406 | 1..403 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7630-RA | 15..417 | 1..403 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7630-RA | 4..406 | 1..403 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7630-RA | 15..417 | 1..403 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 17425491..17425517 | 1..27 | 96 | -> | Plus |
3L | 17425579..17425640 | 28..89 | 100 | -> | Plus |
3L | 17425910..17426079 | 90..259 | 100 | -> | Plus |
3L | 17426139..17426282 | 260..403 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 17425491..17425517 | 1..27 | 96 | -> | Plus |
3L | 17425579..17425640 | 28..89 | 100 | -> | Plus |
3L | 17425910..17426079 | 90..259 | 100 | -> | Plus |
3L | 17426139..17426282 | 260..403 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 17425491..17425517 | 1..27 | 96 | -> | Plus |
3L | 17425579..17425640 | 28..89 | 100 | -> | Plus |
3L | 17425910..17426079 | 90..259 | 100 | -> | Plus |
3L | 17426139..17426282 | 260..403 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 17418591..17418617 | 1..27 | 96 | -> | Plus |
arm_3L | 17418679..17418740 | 28..89 | 100 | -> | Plus |
arm_3L | 17419010..17419179 | 90..259 | 100 | -> | Plus |
arm_3L | 17419239..17419382 | 260..403 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 17418591..17418617 | 1..27 | 96 | -> | Plus |
3L | 17418679..17418740 | 28..89 | 100 | -> | Plus |
3L | 17419010..17419179 | 90..259 | 100 | -> | Plus |
3L | 17419239..17419382 | 260..403 | 100 | Plus |
Translation from 0 to 315
> RH19679.hyp TVQHKVIFGYFRAIMLVKHIVKQGLLLKNAGALSRAAYHGGHGPHSTMND LPVPAGDWKEQHSQKNAKYNAALITGILVLAGTIGFVKSSGIIHFNYYAP KSLD*
Translation from 43 to 315
> RH19679.pep MLVKHIVKQGLLLKNAGALSRAAYHGGHGPHSTMNDLPVPAGDWKEQHSQ KNAKYNAALITGILVLAGTIGFVKSSGIIHFNYYAPKSLD*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF10170-PA | 90 | GF10170-PA | 1..90 | 1..90 | 422 | 88.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG13613-PA | 90 | GG13613-PA | 1..90 | 1..90 | 452 | 94.4 | Plus |
Dere\GG22166-PA | 307 | GG22166-PA | 69..135 | 21..87 | 139 | 37.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH16589-PA | 91 | GH16589-PA | 1..91 | 1..90 | 344 | 75.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG7630-PA | 90 | CG7630-PA | 1..90 | 1..90 | 473 | 100 | Plus |
gom-PA | 305 | CG6727-PA | 70..136 | 21..87 | 149 | 38.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI12436-PA | 90 | GI12436-PA | 1..90 | 1..90 | 386 | 78.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL15579-PA | 91 | GL15579-PA | 1..91 | 1..90 | 375 | 79.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA20492-PA | 91 | GA20492-PA | 1..91 | 1..90 | 375 | 79.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM25696-PA | 90 | GM25696-PA | 1..90 | 1..90 | 465 | 98.9 | Plus |
Dsec\GM15887-PA | 302 | GM15887-PA | 67..133 | 21..87 | 152 | 40.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14704-PA | 90 | GD14704-PA | 1..90 | 1..90 | 465 | 98.9 | Plus |
Dsim\GD11650-PA | 302 | GD11650-PA | 67..133 | 21..87 | 148 | 38.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ12333-PA | 91 | GJ12333-PA | 1..91 | 1..90 | 372 | 78 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK19773-PA | 90 | GK19773-PA | 1..90 | 1..90 | 397 | 82.2 | Plus |