BDGP Sequence Production Resources |
Search the DGRC for RH21090
Library: | RH |
Tissue Source: | Drosophila melanogaster adult head |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2001-04-30 |
Comments: | Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 210 |
Well: | 90 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG17202-RA |
Protein status: | RH21090.pep: gold |
Preliminary Size: | 543 |
Sequenced Size: | 761 |
Gene | Date | Evidence |
---|---|---|
CG17202 | 2002-01-01 | Sim4 clustering to Release 2 |
CG17202 | 2002-03-21 | Blastp of sequenced clone |
CG17202 | 2003-01-01 | Sim4 clustering to Release 3 |
CG17202 | 2008-04-29 | Release 5.5 accounting |
CG17202 | 2008-08-15 | Release 5.9 accounting |
CG17202 | 2008-12-18 | 5.12 accounting |
761 bp (761 high quality bases) assembled on 2002-03-21
GenBank Submission: AY094915
> RH21090.complete GACTTTGGCATTTTTCGAAGTTGCGCCCACAGCCACACCGCACATCTCCA TTTTGCAAAGATGTCCTTTAAGCCCATTGACCCGAAGCGCGACGAGATCC GGCGCTATCTAGAGCGCGGCAGCGTCCTGGACTCGCTGACCAAGCTCTTC ATACGCGTGATCAAGGAGCGGCCCGAGAATCCCATGGACTACATCCGTAA CCACATCGGCGTGGTGCGCCACCAGCACGACAAGTACGAGCGCCTGCAGC AGGATCTGCAGCTGGCCAACGAGGAGATCCAGCGTCTGCGCGCCATCATC AACGGCATCAATCCCGACGTGCTCCAGGGTCATCAGCCAGTGGCTTCAAG TGAAGTAGTGGTCGCAACGGAGGCGCCACAGACCGTGGCCGAGTCCACTG AGGCGGCGGAGCAGCAGCAGCAGCAGCAGCAGCAGGAGAACGGCGAGACT GAGCTGGAGAAACCTAACGAAAGTTCGGCGGACGTTGCGGAGATAACTGC CGCTGTGGAGGCCTGCCAGATTGAGGGGAACTCGGTGGTGACCACCGATG AAGCCGCACAGCCAAGCCCAACCGTCCAAGCTGAAGCCAGTGGCTCCAGT GAGTAGATCTCAGATGACAGCAGCACGTGCCAGCACACACCAAACGTAAA AACAAAAACATCCCATTTAGAACGCATTCATTTAGAAGAAATGTTAAGTA TTTTCCGGAATTTACATGTAAATAAAGCGAAATAAAGCATGAGCGCAAAA AAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG17202-RA | 884 | CG17202-RA | 133..879 | 1..747 | 3735 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\Ulysses | 10653 | Dvir\Ulysses DVULYSS 10653bp AKA(S37633) Derived from X56645 (Rel. 38, Last updated, Version 6). | 2889..2916 | 656..629 | 113 | 89.3 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 8248187..8248258 | 1..72 | 100 | -> | Plus |
chr3R | 8248321..8248994 | 73..746 | 96 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17202-RA | 1..546 | 61..606 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17202-RA | 1..546 | 61..606 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17202-RA | 1..546 | 61..606 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17202-RA | 1..546 | 61..606 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17202-RA | 1..546 | 61..606 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17202-RA | 32..777 | 1..746 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17202-RA | 32..777 | 1..746 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17202-RA | 32..777 | 1..746 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17202-RA | 32..777 | 1..746 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17202-RA | 32..777 | 1..746 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 12422799..12422870 | 1..72 | 100 | -> | Plus |
3R | 12422933..12423606 | 73..746 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 12422799..12422870 | 1..72 | 100 | -> | Plus |
3R | 12422933..12423606 | 73..746 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 12422799..12422870 | 1..72 | 100 | -> | Plus |
3R | 12422933..12423606 | 73..746 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 8248521..8248592 | 1..72 | 100 | -> | Plus |
arm_3R | 8248655..8249328 | 73..746 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 12163764..12164437 | 73..746 | 100 | Plus | |
3R | 12163630..12163701 | 1..72 | 100 | -> | Plus |
Translation from 0 to 605
> RH21090.hyp DFGIFRSCAHSHTAHLHFAKMSFKPIDPKRDEIRRYLERGSVLDSLTKLF IRVIKERPENPMDYIRNHIGVVRHQHDKYERLQQDLQLANEEIQRLRAII NGINPDVLQGHQPVASSEVVVATEAPQTVAESTEAAEQQQQQQQQENGET ELEKPNESSADVAEITAAVEACQIEGNSVVTTDEAAQPSPTVQAEASGSS E*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG17202-PA | 181 | CG17202-PA | 1..181 | 21..201 | 906 | 100 | Plus |
Translation from 60 to 605
> RH21090.pep MSFKPIDPKRDEIRRYLERGSVLDSLTKLFIRVIKERPENPMDYIRNHIG VVRHQHDKYERLQQDLQLANEEIQRLRAIINGINPDVLQGHQPVASSEVV VATEAPQTVAESTEAAEQQQQQQQQENGETELEKPNESSADVAEITAAVE ACQIEGNSVVTTDEAAQPSPTVQAEASGSSE*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF17955-PA | 178 | GF17955-PA | 1..175 | 1..181 | 572 | 65.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG18894-PA | 174 | GG18894-PA | 1..174 | 1..181 | 717 | 80.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH13886-PA | 177 | GH13886-PA | 1..174 | 1..179 | 461 | 55.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG17202-PA | 181 | CG17202-PA | 1..181 | 1..181 | 906 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI24827-PA | 187 | GI24827-PA | 1..181 | 1..177 | 461 | 55.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL27310-PA | 196 | GL27310-PA | 1..191 | 1..181 | 478 | 54.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA14386-PA | 196 | GA14386-PA | 1..191 | 1..181 | 467 | 53.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM24030-PA | 177 | GM24030-PA | 1..177 | 1..181 | 827 | 89.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD18831-PA | 174 | GD18831-PA | 1..174 | 1..181 | 816 | 89 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ24470-PA | 184 | GJ24470-PA | 1..176 | 1..175 | 482 | 59.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK14402-PA | 195 | GK14402-PA | 1..94 | 1..95 | 447 | 86.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE26191-PA | 176 | GE26191-PA | 1..176 | 1..181 | 739 | 82.5 | Plus |