Clone RH21090 Report

Search the DGRC for RH21090

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:210
Well:90
Vector:pFlc-1
Associated Gene/TranscriptCG17202-RA
Protein status:RH21090.pep: gold
Preliminary Size:543
Sequenced Size:761

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17202 2002-01-01 Sim4 clustering to Release 2
CG17202 2002-03-21 Blastp of sequenced clone
CG17202 2003-01-01 Sim4 clustering to Release 3
CG17202 2008-04-29 Release 5.5 accounting
CG17202 2008-08-15 Release 5.9 accounting
CG17202 2008-12-18 5.12 accounting

Clone Sequence Records

RH21090.complete Sequence

761 bp (761 high quality bases) assembled on 2002-03-21

GenBank Submission: AY094915

> RH21090.complete
GACTTTGGCATTTTTCGAAGTTGCGCCCACAGCCACACCGCACATCTCCA
TTTTGCAAAGATGTCCTTTAAGCCCATTGACCCGAAGCGCGACGAGATCC
GGCGCTATCTAGAGCGCGGCAGCGTCCTGGACTCGCTGACCAAGCTCTTC
ATACGCGTGATCAAGGAGCGGCCCGAGAATCCCATGGACTACATCCGTAA
CCACATCGGCGTGGTGCGCCACCAGCACGACAAGTACGAGCGCCTGCAGC
AGGATCTGCAGCTGGCCAACGAGGAGATCCAGCGTCTGCGCGCCATCATC
AACGGCATCAATCCCGACGTGCTCCAGGGTCATCAGCCAGTGGCTTCAAG
TGAAGTAGTGGTCGCAACGGAGGCGCCACAGACCGTGGCCGAGTCCACTG
AGGCGGCGGAGCAGCAGCAGCAGCAGCAGCAGCAGGAGAACGGCGAGACT
GAGCTGGAGAAACCTAACGAAAGTTCGGCGGACGTTGCGGAGATAACTGC
CGCTGTGGAGGCCTGCCAGATTGAGGGGAACTCGGTGGTGACCACCGATG
AAGCCGCACAGCCAAGCCCAACCGTCCAAGCTGAAGCCAGTGGCTCCAGT
GAGTAGATCTCAGATGACAGCAGCACGTGCCAGCACACACCAAACGTAAA
AACAAAAACATCCCATTTAGAACGCATTCATTTAGAAGAAATGTTAAGTA
TTTTCCGGAATTTACATGTAAATAAAGCGAAATAAAGCATGAGCGCAAAA
AAAAAAAAAAA

RH21090.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:19:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG17202-RA 884 CG17202-RA 133..879 1..747 3735 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 20:50:00
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 8248319..8248994 71..746 3380 100 Plus
chr3R 27901430 chr3R 8248187..8248258 1..72 360 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:24:20 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 20:49:58
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 12422931..12423607 71..747 3385 100 Plus
3R 32079331 3R 12422799..12422870 1..72 360 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:48:54
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 12163762..12164438 71..747 3385 100 Plus
3R 31820162 3R 12163630..12163701 1..72 360 100 Plus
Blast to na_te.dros performed 2019-03-16 20:49:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Ulysses 10653 Dvir\Ulysses DVULYSS 10653bp AKA(S37633) Derived from X56645 (Rel. 38, Last updated, Version 6). 2889..2916 656..629 113 89.3 Minus

RH21090.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 20:50:59 Download gff for RH21090.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 8248187..8248258 1..72 100 -> Plus
chr3R 8248321..8248994 73..746 96   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:43:06 Download gff for RH21090.complete
Subject Subject Range Query Range Percent Splice Strand
CG17202-RA 1..546 61..606 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:24:30 Download gff for RH21090.complete
Subject Subject Range Query Range Percent Splice Strand
CG17202-RA 1..546 61..606 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:40:11 Download gff for RH21090.complete
Subject Subject Range Query Range Percent Splice Strand
CG17202-RA 1..546 61..606 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:00:20 Download gff for RH21090.complete
Subject Subject Range Query Range Percent Splice Strand
CG17202-RA 1..546 61..606 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:56:04 Download gff for RH21090.complete
Subject Subject Range Query Range Percent Splice Strand
CG17202-RA 1..546 61..606 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:51:11 Download gff for RH21090.complete
Subject Subject Range Query Range Percent Splice Strand
CG17202-RA 32..777 1..746 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:24:29 Download gff for RH21090.complete
Subject Subject Range Query Range Percent Splice Strand
CG17202-RA 32..777 1..746 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:40:11 Download gff for RH21090.complete
Subject Subject Range Query Range Percent Splice Strand
CG17202-RA 32..777 1..746 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:00:20 Download gff for RH21090.complete
Subject Subject Range Query Range Percent Splice Strand
CG17202-RA 32..777 1..746 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:56:04 Download gff for RH21090.complete
Subject Subject Range Query Range Percent Splice Strand
CG17202-RA 32..777 1..746 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:50:59 Download gff for RH21090.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12422799..12422870 1..72 100 -> Plus
3R 12422933..12423606 73..746 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:50:59 Download gff for RH21090.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12422799..12422870 1..72 100 -> Plus
3R 12422933..12423606 73..746 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:50:59 Download gff for RH21090.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12422799..12422870 1..72 100 -> Plus
3R 12422933..12423606 73..746 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:40:11 Download gff for RH21090.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8248521..8248592 1..72 100 -> Plus
arm_3R 8248655..8249328 73..746 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:33:21 Download gff for RH21090.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12163764..12164437 73..746 100   Plus
3R 12163630..12163701 1..72 100 -> Plus

RH21090.hyp Sequence

Translation from 0 to 605

> RH21090.hyp
DFGIFRSCAHSHTAHLHFAKMSFKPIDPKRDEIRRYLERGSVLDSLTKLF
IRVIKERPENPMDYIRNHIGVVRHQHDKYERLQQDLQLANEEIQRLRAII
NGINPDVLQGHQPVASSEVVVATEAPQTVAESTEAAEQQQQQQQQENGET
ELEKPNESSADVAEITAAVEACQIEGNSVVTTDEAAQPSPTVQAEASGSS
E*

RH21090.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:26:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG17202-PA 181 CG17202-PA 1..181 21..201 906 100 Plus

RH21090.pep Sequence

Translation from 60 to 605

> RH21090.pep
MSFKPIDPKRDEIRRYLERGSVLDSLTKLFIRVIKERPENPMDYIRNHIG
VVRHQHDKYERLQQDLQLANEEIQRLRAIINGINPDVLQGHQPVASSEVV
VATEAPQTVAESTEAAEQQQQQQQQENGETELEKPNESSADVAEITAAVE
ACQIEGNSVVTTDEAAQPSPTVQAEASGSSE*

RH21090.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:29:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17955-PA 178 GF17955-PA 1..175 1..181 572 65.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:29:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18894-PA 174 GG18894-PA 1..174 1..181 717 80.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:29:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13886-PA 177 GH13886-PA 1..174 1..179 461 55.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:58:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG17202-PA 181 CG17202-PA 1..181 1..181 906 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:29:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24827-PA 187 GI24827-PA 1..181 1..177 461 55.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:29:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL27310-PA 196 GL27310-PA 1..191 1..181 478 54.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:29:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14386-PA 196 GA14386-PA 1..191 1..181 467 53.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:29:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24030-PA 177 GM24030-PA 1..177 1..181 827 89.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:29:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18831-PA 174 GD18831-PA 1..174 1..181 816 89 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:29:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24470-PA 184 GJ24470-PA 1..176 1..175 482 59.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:29:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14402-PA 195 GK14402-PA 1..94 1..95 447 86.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:29:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26191-PA 176 GE26191-PA 1..176 1..181 739 82.5 Plus