BDGP Sequence Production Resources |
Search the DGRC for RH21608
Library: | RH |
Tissue Source: | Drosophila melanogaster adult head |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2001-04-30 |
Comments: | Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 216 |
Well: | 8 |
Vector: | pFlc-1 |
Associated Gene/Transcript | RpII18-RA |
Protein status: | RH21608.pep: gold |
Sequenced Size: | 553 |
Gene | Date | Evidence |
---|---|---|
CG1163 | 2002-10-23 | Blastp of sequenced clone |
CG1163 | 2003-01-01 | Sim4 clustering to Release 3 |
RpII18 | 2008-04-29 | Release 5.5 accounting |
RpII18 | 2008-08-15 | Release 5.9 accounting |
RpII18 | 2008-12-18 | 5.12 accounting |
553 bp (553 high quality bases) assembled on 2002-10-23
GenBank Submission: BT001786
> RH21608.complete GAGTGTGAAAGAAGAAGAAGACTGCGACGCGTGCAAAACACGCCGCACTT TACTATTTAATTTCGATTAAAACAATAGAAAAGCAGTGATGGATGATGCG GACTACGACAACGACGACGTTGGCGGCGATGACTTCGACGACGTCGACGA GGACGTGGACGAGGACATTAACCAGGAGGAGGAGGCGGACAACATCGAGA TCATAGCTCCCGGTGGTGCGGGCGGAGGCGGTGTGCCCAAGTCCAAGCGC ATTACCACAAAGTACATGACGAAATACGAGCGCGCCAGAGTTCTGGGCAC ACGAGCGCTTCAGATCGCCATGTGCGCACCCATCATGGTGGAGCTGGACG GGGAAACGGACCCCCTGCAGATCGCCATGAAAGAGCTGAAACAAAAGAAA ATTCCCATCATCATCCGCCGATACCTGCCGGATCACTCCTACGAGGACTG GAGCATCGACGAGCTCATCATGGTGGACAACTAGCTAGTACTCAACCCCT TTATCCATAATAAATCATACCGCCTAAGATTAAGCACAAAAAAAAAAAAA AAA
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 1197457..1197574 | 1..117 | 99 | -> | Plus |
chr3R | 1197637..1198056 | 118..537 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpII18-RA | 1..396 | 89..484 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpII18-RA | 1..396 | 89..484 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpII18-RA | 1..396 | 89..484 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpII18-RA | 1..396 | 89..484 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpII18-RA | 1..396 | 89..484 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpII18-RA | 1..538 | 1..537 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpII18-RA | 33..570 | 1..537 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpII18-RA | 4..541 | 1..537 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpII18-RA | 1..538 | 1..537 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpII18-RA | 4..541 | 1..537 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 5371798..5371915 | 1..117 | 99 | -> | Plus |
3R | 5371978..5372397 | 118..537 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 5371798..5371915 | 1..117 | 99 | -> | Plus |
3R | 5371978..5372397 | 118..537 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 5371798..5371915 | 1..117 | 99 | -> | Plus |
3R | 5371978..5372397 | 118..537 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 1197520..1197637 | 1..117 | 99 | -> | Plus |
arm_3R | 1197700..1198119 | 118..537 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 5112809..5113228 | 118..537 | 100 | Plus | |
3R | 5112629..5112746 | 1..117 | 99 | -> | Plus |
Translation from 88 to 483
> RH21608.pep MDDADYDNDDVGGDDFDDVDEDVDEDINQEEEADNIEIIAPGGAGGGGVP KSKRITTKYMTKYERARVLGTRALQIAMCAPIMVELDGETDPLQIAMKEL KQKKIPIIIRRYLPDHSYEDWSIDELIMVDN*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF17248-PA | 131 | GF17248-PA | 1..131 | 1..131 | 646 | 96.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG12771-PA | 131 | GG12771-PA | 1..131 | 1..131 | 672 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH17834-PA | 131 | GH17834-PA | 27..131 | 27..131 | 526 | 95.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpII18-PA | 131 | CG1163-PA | 1..131 | 1..131 | 686 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI22548-PA | 131 | GI22548-PA | 1..131 | 1..131 | 491 | 95.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL21641-PA | 131 | GL21641-PA | 1..131 | 1..131 | 644 | 96.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA11109-PA | 131 | GA11109-PA | 1..131 | 1..131 | 644 | 96.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM10803-PA | 131 | GM10803-PA | 1..131 | 1..131 | 660 | 98.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD19782-PA | 131 | GD19782-PA | 27..131 | 27..131 | 474 | 95.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ11106-PA | 131 | GJ11106-PA | 1..131 | 1..131 | 649 | 96.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK11847-PA | 132 | GK11847-PA | 27..132 | 27..131 | 472 | 93.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE25464-PA | 131 | GE25464-PA | 1..131 | 1..131 | 672 | 100 | Plus |
Translation from 88 to 483
> RH21608.hyp MDDADYDNDDVGGDDFDDVDEDVDEDINQEEEADNIEIIAPGGAGGGGVP KSKRITTKYMTKYERARVLGTRALQIAMCAPIMVELDGETDPLQIAMKEL KQKKIPIIIRRYLPDHSYEDWSIDELIMVDN*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpII18-PA | 131 | CG1163-PA | 1..131 | 1..131 | 686 | 100 | Plus |