Clone RH21608 Report

Search the DGRC for RH21608

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:216
Well:8
Vector:pFlc-1
Associated Gene/TranscriptRpII18-RA
Protein status:RH21608.pep: gold
Sequenced Size:553

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1163 2002-10-23 Blastp of sequenced clone
CG1163 2003-01-01 Sim4 clustering to Release 3
RpII18 2008-04-29 Release 5.5 accounting
RpII18 2008-08-15 Release 5.9 accounting
RpII18 2008-12-18 5.12 accounting

Clone Sequence Records

RH21608.complete Sequence

553 bp (553 high quality bases) assembled on 2002-10-23

GenBank Submission: BT001786

> RH21608.complete
GAGTGTGAAAGAAGAAGAAGACTGCGACGCGTGCAAAACACGCCGCACTT
TACTATTTAATTTCGATTAAAACAATAGAAAAGCAGTGATGGATGATGCG
GACTACGACAACGACGACGTTGGCGGCGATGACTTCGACGACGTCGACGA
GGACGTGGACGAGGACATTAACCAGGAGGAGGAGGCGGACAACATCGAGA
TCATAGCTCCCGGTGGTGCGGGCGGAGGCGGTGTGCCCAAGTCCAAGCGC
ATTACCACAAAGTACATGACGAAATACGAGCGCGCCAGAGTTCTGGGCAC
ACGAGCGCTTCAGATCGCCATGTGCGCACCCATCATGGTGGAGCTGGACG
GGGAAACGGACCCCCTGCAGATCGCCATGAAAGAGCTGAAACAAAAGAAA
ATTCCCATCATCATCCGCCGATACCTGCCGGATCACTCCTACGAGGACTG
GAGCATCGACGAGCTCATCATGGTGGACAACTAGCTAGTACTCAACCCCT
TTATCCATAATAAATCATACCGCCTAAGATTAAGCACAAAAAAAAAAAAA
AAA

RH21608.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:35:51
Subject Length Description Subject Range Query Range Score Percent Strand
RpII18.a 869 RpII18.a 212..749 2..539 2690 100 Plus
RpII18-RA 758 RpII18-RA 101..638 2..539 2690 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:52:00
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 1197637..1198056 118..537 2100 100 Plus
chr3R 27901430 chr3R 1197459..1197574 2..117 580 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:24:26 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:51:58
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 5371978..5372399 118..539 2110 100 Plus
3R 32079331 3R 5371800..5371915 2..117 580 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:10:13
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 5112809..5113230 118..539 2110 100 Plus
3R 31820162 3R 5112631..5112746 2..117 580 100 Plus
Blast to na_te.dros performed on 2019-03-16 19:51:58 has no hits.

RH21608.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:53:07 Download gff for RH21608.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 1197457..1197574 1..117 99 -> Plus
chr3R 1197637..1198056 118..537 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:43:11 Download gff for RH21608.complete
Subject Subject Range Query Range Percent Splice Strand
RpII18-RA 1..396 89..484 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:07:20 Download gff for RH21608.complete
Subject Subject Range Query Range Percent Splice Strand
RpII18-RA 1..396 89..484 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:35:14 Download gff for RH21608.complete
Subject Subject Range Query Range Percent Splice Strand
RpII18-RA 1..396 89..484 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:57:13 Download gff for RH21608.complete
Subject Subject Range Query Range Percent Splice Strand
RpII18-RA 1..396 89..484 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:44:30 Download gff for RH21608.complete
Subject Subject Range Query Range Percent Splice Strand
RpII18-RA 1..396 89..484 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:27:25 Download gff for RH21608.complete
Subject Subject Range Query Range Percent Splice Strand
RpII18-RA 1..538 1..537 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:07:20 Download gff for RH21608.complete
Subject Subject Range Query Range Percent Splice Strand
RpII18-RA 33..570 1..537 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:35:14 Download gff for RH21608.complete
Subject Subject Range Query Range Percent Splice Strand
RpII18-RA 4..541 1..537 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:57:13 Download gff for RH21608.complete
Subject Subject Range Query Range Percent Splice Strand
RpII18-RA 1..538 1..537 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:44:30 Download gff for RH21608.complete
Subject Subject Range Query Range Percent Splice Strand
RpII18-RA 4..541 1..537 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:53:07 Download gff for RH21608.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5371798..5371915 1..117 99 -> Plus
3R 5371978..5372397 118..537 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:53:07 Download gff for RH21608.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5371798..5371915 1..117 99 -> Plus
3R 5371978..5372397 118..537 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:53:07 Download gff for RH21608.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5371798..5371915 1..117 99 -> Plus
3R 5371978..5372397 118..537 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:35:14 Download gff for RH21608.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 1197520..1197637 1..117 99 -> Plus
arm_3R 1197700..1198119 118..537 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:29:37 Download gff for RH21608.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5112809..5113228 118..537 100   Plus
3R 5112629..5112746 1..117 99 -> Plus

RH21608.pep Sequence

Translation from 88 to 483

> RH21608.pep
MDDADYDNDDVGGDDFDDVDEDVDEDINQEEEADNIEIIAPGGAGGGGVP
KSKRITTKYMTKYERARVLGTRALQIAMCAPIMVELDGETDPLQIAMKEL
KQKKIPIIIRRYLPDHSYEDWSIDELIMVDN*

RH21608.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:02:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17248-PA 131 GF17248-PA 1..131 1..131 646 96.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:02:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12771-PA 131 GG12771-PA 1..131 1..131 672 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:02:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17834-PA 131 GH17834-PA 27..131 27..131 526 95.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:40:24
Subject Length Description Subject Range Query Range Score Percent Strand
RpII18-PA 131 CG1163-PA 1..131 1..131 686 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:02:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22548-PA 131 GI22548-PA 1..131 1..131 491 95.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:02:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21641-PA 131 GL21641-PA 1..131 1..131 644 96.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:02:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11109-PA 131 GA11109-PA 1..131 1..131 644 96.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:02:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10803-PA 131 GM10803-PA 1..131 1..131 660 98.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:02:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19782-PA 131 GD19782-PA 27..131 27..131 474 95.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:02:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11106-PA 131 GJ11106-PA 1..131 1..131 649 96.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:02:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11847-PA 132 GK11847-PA 27..132 27..131 472 93.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:02:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25464-PA 131 GE25464-PA 1..131 1..131 672 100 Plus

RH21608.hyp Sequence

Translation from 88 to 483

> RH21608.hyp
MDDADYDNDDVGGDDFDDVDEDVDEDINQEEEADNIEIIAPGGAGGGGVP
KSKRITTKYMTKYERARVLGTRALQIAMCAPIMVELDGETDPLQIAMKEL
KQKKIPIIIRRYLPDHSYEDWSIDELIMVDN*

RH21608.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:19:06
Subject Length Description Subject Range Query Range Score Percent Strand
RpII18-PA 131 CG1163-PA 1..131 1..131 686 100 Plus