Clone RH21839 Report

Search the DGRC for RH21839

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:218
Well:39
Vector:pFlc-1
Associated Gene/TranscriptUcrh-RB
Protein status:RH21839.pep: gold
Sequenced Size:414

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Lost to the ancients 2010-01-14 I'm sure there was a reason

Clone Sequence Records

RH21839.complete Sequence

414 bp assembled on 2010-01-18

GenBank Submission: BT120150.1

> RH21839.complete
GACATTGTGATTGCATCATAGCGGTCTTAAAGGTTATAGTTATTTTTCAA
AAATCATTAATAATGGCTTTTAGGAACTGGTTTTCGCTTCCCGCCGTCAG
AGCTGATGACGAAGAGGACTTAGTTGACCCTCAAGCAGTTTTAAGGGAAA
AATGTCAAGCTAAAGGTCACATAGAATCCTTGTACAATAAGTACCAAGAG
TGCAATGATCGTGTTAATGGGCGATCCAAAACAACTGAGACTTGCATCGA
AGAATTATTTGACTATGTTGCTGAGTTAGATCATTGCGTTTCGCACAGTC
TTTTTACAAAGCTTAAGTAAATACCATTAAAGTCAATTCCATTAAAGGGA
AGGGCAGTGCTTAAAAATAAGAACATAAATAAACAAATCTCTTTATCCAA
AAAAAAAAAAAAAA

RH21839.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:34:38
Subject Length Description Subject Range Query Range Score Percent Strand
Ucrh-RB 903 Ucrh-RB 53..448 2..397 1980 100 Plus
Ucrh.b 1113 Ucrh.b 53..448 2..397 1980 100 Plus
Ucrh-RD 513 Ucrh-RD 94..436 55..397 1715 100 Plus
Ucrh-RD 513 Ucrh-RD 25..77 2..54 265 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:07:13
Subject Length Description Subject Range Query Range Score Percent Strand
chr3LHet 2555433 chr3LHet 606499..606750 146..397 1260 100 Plus
chr3LHet 2555433 chr3LHet 606350..606447 55..152 475 99 Plus
chr2R 21145070 chr2R 4564961..4565158 104..301 435 81.3 Plus
chr3LHet 2555433 chr3LHet 606222..606274 2..54 265 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed 2010-04-22 21:24:31
Subject Length Description Subject Range Query Range Score Percent Strand
CR41111-RB 498 CR41111-RB 2..149 2..149 740 100 Plus
CR41111-RA 1075 CR41111-RA 12..159 2..149 740 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:07:12
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 25121043..25121294 146..397 1260 100 Plus
3L 28110227 3L 25120894..25120991 55..152 475 99 Plus
2R 25286936 2R 8677379..8677576 104..301 435 81.3 Plus
3L 28110227 3L 25120766..25120818 2..54 265 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:51:33
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 25114143..25114394 146..397 1260 100 Plus
3L 28103327 3L 25113994..25114091 55..152 475 98.9 Plus
2R 25260384 2R 8678578..8678775 104..301 435 81.3 Plus
3L 28103327 3L 25113866..25113918 2..54 265 100 Plus
Blast to na_te.dros performed on 2019-03-15 23:07:12 has no hits.

RH21839.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:08:08 Download gff for RH21839.complete
Subject Subject Range Query Range Percent Splice Strand
chr3LHet 606221..606274 1..54 98 -> Plus
chr3LHet 606350..606441 55..146 100 -> Plus
chr3LHet 606500..606750 147..398 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-01-18 12:25:39 Download gff for RH21839.complete
Subject Subject Range Query Range Percent Splice Strand
CG41623-RA 1..318 3..320 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:53:06 Download gff for RH21839.complete
Subject Subject Range Query Range Percent Splice Strand
Ucrh-RD 1..258 63..320 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:28:16 Download gff for RH21839.complete
Subject Subject Range Query Range Percent Splice Strand
Ucrh-RB 1..258 63..320 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:19:48 Download gff for RH21839.complete
Subject Subject Range Query Range Percent Splice Strand
Ucrh-RB 1..258 63..320 100   Plus
Sim4 to dmel-all-all_noncoding-r5.12.fasta performed 2010-04-22 21:24:31 Download gff for RH21839.complete
Subject Subject Range Query Range Percent Splice Strand
CR41111-RA 11..168 1..156 97   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-01-18 12:25:38 Download gff for RH21839.complete
Subject Subject Range Query Range Percent Splice Strand
CG41623-RA 2..397 2..398 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:53:06 Download gff for RH21839.complete
Subject Subject Range Query Range Percent Splice Strand
Ucrh-RB 13..409 1..398 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:28:16 Download gff for RH21839.complete
Subject Subject Range Query Range Percent Splice Strand
Ucrh-RB 17..413 1..398 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:19:48 Download gff for RH21839.complete
Subject Subject Range Query Range Percent Splice Strand
Ucrh-RB 17..413 1..398 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:08:08 Download gff for RH21839.complete
Subject Subject Range Query Range Percent Splice Strand
3L 25120765..25120818 1..54 98 -> Plus
3L 25120894..25120985 55..146 100 -> Plus
3L 25121044..25121294 147..398 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:08:08 Download gff for RH21839.complete
Subject Subject Range Query Range Percent Splice Strand
3L 25120765..25120818 1..54 98 -> Plus
3L 25120894..25120985 55..146 100 -> Plus
3L 25121044..25121294 147..398 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:08:08 Download gff for RH21839.complete
Subject Subject Range Query Range Percent Splice Strand
3L 25120765..25120818 1..54 98 -> Plus
3L 25120894..25120985 55..146 100 -> Plus
3L 25121044..25121294 147..398 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:28:16 Download gff for RH21839.complete
Subject Subject Range Query Range Percent Splice Strand
3LHet 606221..606274 1..54 98 -> Plus
3LHet 606350..606441 55..146 100 -> Plus
3LHet 606500..606750 147..398 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:29:22 Download gff for RH21839.complete
Subject Subject Range Query Range Percent Splice Strand
3L 25114144..25114394 147..398 99   Plus
3L 25113865..25113918 1..54 98 -> Plus
3L 25113994..25114085 55..146 100 -> Plus

RH21839.hyp Sequence

Translation from 2 to 319

> RH21839.hyp
HCDCIIAVLKVIVIFQKSLIMAFRNWFSLPAVRADDEEDLVDPQAVLREK
CQAKGHIESLYNKYQECNDRVNGRSKTTETCIEELFDYVAELDHCVSHSL
FTKLK*

RH21839.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:40:59
Subject Length Description Subject Range Query Range Score Percent Strand
Ucrh-PD 85 CG41623-PD 1..85 21..105 456 100 Plus
Ucrh-PC 85 CG41623-PC 1..85 21..105 456 100 Plus
Ucrh-PB 85 CG41623-PB 1..85 21..105 456 100 Plus
CG30354-PB 86 CG30354-PB 1..86 21..105 360 77.9 Plus
CG30354-PA 86 CG30354-PA 1..86 21..105 360 77.9 Plus

RH21839.pep Sequence

Translation from 2 to 319

> RH21839.pep
HCDCIIAVLKVIVIFQKSLIMAFRNWFSLPAVRADDEEDLVDPQAVLREK
CQAKGHIESLYNKYQECNDRVNGRSKTTETCIEELFDYVAELDHCVSHSL
FTKLK*

RH21839.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 20:32:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23099-PA 84 GF23099-PA 1..84 20..105 382 80.2 Plus
Dana\GF18375-PA 98 GF18375-PA 1..98 21..105 301 60.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 20:32:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11966-PA 85 GG11966-PA 1..85 21..105 444 95.3 Plus
Dere\GG23376-PA 820 GG23376-PA 58..137 17..95 339 75 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 20:32:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22364-PA 86 GH22364-PA 1..86 21..105 372 81.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:20:40
Subject Length Description Subject Range Query Range Score Percent Strand
UQCR-11-PD 85 CG41623-PD 1..85 21..105 456 100 Plus
UQCR-11-PC 85 CG41623-PC 1..85 21..105 456 100 Plus
UQCR-11-PB 85 CG41623-PB 1..85 21..105 456 100 Plus
UQCR-11L-PB 86 CG30354-PB 1..86 21..105 360 77.9 Plus
UQCR-11L-PA 86 CG30354-PA 1..86 21..105 360 77.9 Plus
UQCR-11-PE 35 CG41623-PE 1..29 21..49 151 100 Plus
UQCR-11-PF 35 CG41623-PF 1..29 21..49 151 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 20:32:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23618-PA 86 GI23618-PA 1..86 21..105 378 83.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 20:32:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12348-PA 77 GL12348-PA 1..77 29..105 382 89.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 20:32:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\Ucrh-PA 85 GA27479-PA 1..85 21..105 415 87.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 20:32:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18768-PA 85 GM18768-PA 1..85 21..105 452 97.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 20:32:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11930-PA 85 GD11930-PA 1..85 21..105 452 97.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 20:32:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23592-PA 86 GJ23592-PA 1..86 21..105 374 82.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 20:32:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14352-PA 86 GK14352-PA 1..86 21..105 384 81.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 20:32:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25384-PA 85 GE25384-PA 1..85 21..105 450 97.6 Plus