BDGP Sequence Production Resources |
Search the DGRC for RH21839
Library: | RH |
Tissue Source: | Drosophila melanogaster adult head |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2001-04-30 |
Comments: | Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 218 |
Well: | 39 |
Vector: | pFlc-1 |
Associated Gene/Transcript | Ucrh-RB |
Protein status: | RH21839.pep: gold |
Sequenced Size: | 414 |
Gene | Date | Evidence |
---|---|---|
Lost to the ancients | 2010-01-14 | I'm sure there was a reason |
414 bp assembled on 2010-01-18
GenBank Submission: BT120150.1
> RH21839.complete GACATTGTGATTGCATCATAGCGGTCTTAAAGGTTATAGTTATTTTTCAA AAATCATTAATAATGGCTTTTAGGAACTGGTTTTCGCTTCCCGCCGTCAG AGCTGATGACGAAGAGGACTTAGTTGACCCTCAAGCAGTTTTAAGGGAAA AATGTCAAGCTAAAGGTCACATAGAATCCTTGTACAATAAGTACCAAGAG TGCAATGATCGTGTTAATGGGCGATCCAAAACAACTGAGACTTGCATCGA AGAATTATTTGACTATGTTGCTGAGTTAGATCATTGCGTTTCGCACAGTC TTTTTACAAAGCTTAAGTAAATACCATTAAAGTCAATTCCATTAAAGGGA AGGGCAGTGCTTAAAAATAAGAACATAAATAAACAAATCTCTTTATCCAA AAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Ucrh-RB | 903 | Ucrh-RB | 53..448 | 2..397 | 1980 | 100 | Plus |
Ucrh.b | 1113 | Ucrh.b | 53..448 | 2..397 | 1980 | 100 | Plus |
Ucrh-RD | 513 | Ucrh-RD | 94..436 | 55..397 | 1715 | 100 | Plus |
Ucrh-RD | 513 | Ucrh-RD | 25..77 | 2..54 | 265 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3LHet | 2555433 | chr3LHet | 606499..606750 | 146..397 | 1260 | 100 | Plus |
chr3LHet | 2555433 | chr3LHet | 606350..606447 | 55..152 | 475 | 99 | Plus |
chr2R | 21145070 | chr2R | 4564961..4565158 | 104..301 | 435 | 81.3 | Plus |
chr3LHet | 2555433 | chr3LHet | 606222..606274 | 2..54 | 265 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 25121043..25121294 | 146..397 | 1260 | 100 | Plus |
3L | 28110227 | 3L | 25120894..25120991 | 55..152 | 475 | 99 | Plus |
2R | 25286936 | 2R | 8677379..8677576 | 104..301 | 435 | 81.3 | Plus |
3L | 28110227 | 3L | 25120766..25120818 | 2..54 | 265 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 25114143..25114394 | 146..397 | 1260 | 100 | Plus |
3L | 28103327 | 3L | 25113994..25114091 | 55..152 | 475 | 98.9 | Plus |
2R | 25260384 | 2R | 8678578..8678775 | 104..301 | 435 | 81.3 | Plus |
3L | 28103327 | 3L | 25113866..25113918 | 2..54 | 265 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3LHet | 606221..606274 | 1..54 | 98 | -> | Plus |
chr3LHet | 606350..606441 | 55..146 | 100 | -> | Plus |
chr3LHet | 606500..606750 | 147..398 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG41623-RA | 1..318 | 3..320 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Ucrh-RD | 1..258 | 63..320 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Ucrh-RB | 1..258 | 63..320 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Ucrh-RB | 1..258 | 63..320 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CR41111-RA | 11..168 | 1..156 | 97 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG41623-RA | 2..397 | 2..398 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Ucrh-RB | 13..409 | 1..398 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Ucrh-RB | 17..413 | 1..398 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Ucrh-RB | 17..413 | 1..398 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 25120765..25120818 | 1..54 | 98 | -> | Plus |
3L | 25120894..25120985 | 55..146 | 100 | -> | Plus |
3L | 25121044..25121294 | 147..398 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 25120765..25120818 | 1..54 | 98 | -> | Plus |
3L | 25120894..25120985 | 55..146 | 100 | -> | Plus |
3L | 25121044..25121294 | 147..398 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 25120765..25120818 | 1..54 | 98 | -> | Plus |
3L | 25120894..25120985 | 55..146 | 100 | -> | Plus |
3L | 25121044..25121294 | 147..398 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3LHet | 606221..606274 | 1..54 | 98 | -> | Plus |
3LHet | 606350..606441 | 55..146 | 100 | -> | Plus |
3LHet | 606500..606750 | 147..398 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 25114144..25114394 | 147..398 | 99 | Plus | |
3L | 25113865..25113918 | 1..54 | 98 | -> | Plus |
3L | 25113994..25114085 | 55..146 | 100 | -> | Plus |
Translation from 2 to 319
> RH21839.hyp HCDCIIAVLKVIVIFQKSLIMAFRNWFSLPAVRADDEEDLVDPQAVLREK CQAKGHIESLYNKYQECNDRVNGRSKTTETCIEELFDYVAELDHCVSHSL FTKLK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Ucrh-PD | 85 | CG41623-PD | 1..85 | 21..105 | 456 | 100 | Plus |
Ucrh-PC | 85 | CG41623-PC | 1..85 | 21..105 | 456 | 100 | Plus |
Ucrh-PB | 85 | CG41623-PB | 1..85 | 21..105 | 456 | 100 | Plus |
CG30354-PB | 86 | CG30354-PB | 1..86 | 21..105 | 360 | 77.9 | Plus |
CG30354-PA | 86 | CG30354-PA | 1..86 | 21..105 | 360 | 77.9 | Plus |
Translation from 2 to 319
> RH21839.pep HCDCIIAVLKVIVIFQKSLIMAFRNWFSLPAVRADDEEDLVDPQAVLREK CQAKGHIESLYNKYQECNDRVNGRSKTTETCIEELFDYVAELDHCVSHSL FTKLK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF23099-PA | 84 | GF23099-PA | 1..84 | 20..105 | 382 | 80.2 | Plus |
Dana\GF18375-PA | 98 | GF18375-PA | 1..98 | 21..105 | 301 | 60.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG11966-PA | 85 | GG11966-PA | 1..85 | 21..105 | 444 | 95.3 | Plus |
Dere\GG23376-PA | 820 | GG23376-PA | 58..137 | 17..95 | 339 | 75 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH22364-PA | 86 | GH22364-PA | 1..86 | 21..105 | 372 | 81.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
UQCR-11-PD | 85 | CG41623-PD | 1..85 | 21..105 | 456 | 100 | Plus |
UQCR-11-PC | 85 | CG41623-PC | 1..85 | 21..105 | 456 | 100 | Plus |
UQCR-11-PB | 85 | CG41623-PB | 1..85 | 21..105 | 456 | 100 | Plus |
UQCR-11L-PB | 86 | CG30354-PB | 1..86 | 21..105 | 360 | 77.9 | Plus |
UQCR-11L-PA | 86 | CG30354-PA | 1..86 | 21..105 | 360 | 77.9 | Plus |
UQCR-11-PE | 35 | CG41623-PE | 1..29 | 21..49 | 151 | 100 | Plus |
UQCR-11-PF | 35 | CG41623-PF | 1..29 | 21..49 | 151 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI23618-PA | 86 | GI23618-PA | 1..86 | 21..105 | 378 | 83.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL12348-PA | 77 | GL12348-PA | 1..77 | 29..105 | 382 | 89.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\Ucrh-PA | 85 | GA27479-PA | 1..85 | 21..105 | 415 | 87.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM18768-PA | 85 | GM18768-PA | 1..85 | 21..105 | 452 | 97.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD11930-PA | 85 | GD11930-PA | 1..85 | 21..105 | 452 | 97.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ23592-PA | 86 | GJ23592-PA | 1..86 | 21..105 | 374 | 82.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK14352-PA | 86 | GK14352-PA | 1..86 | 21..105 | 384 | 81.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE25384-PA | 85 | GE25384-PA | 1..85 | 21..105 | 450 | 97.6 | Plus |