Clone RH22148 Report

Search the DGRC for RH22148

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:221
Well:48
Vector:pFlc-1
Associated Gene/TranscriptCG12025-RA
Protein status:RH22148.pep: gold
Preliminary Size:825
Sequenced Size:1232

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12025 2002-01-01 Sim4 clustering to Release 2
CG12025 2002-05-18 Blastp of sequenced clone
CG12025 2003-01-01 Sim4 clustering to Release 3
CG12025 2008-04-29 Release 5.5 accounting
CG12025 2008-08-15 Release 5.9 accounting
CG12025 2008-12-18 5.12 accounting

Clone Sequence Records

RH22148.complete Sequence

1232 bp (1232 high quality bases) assembled on 2002-05-18

GenBank Submission: AY119162

> RH22148.complete
GACACAGTATTTAACCACCCCCGAGGAACGGTCACATTGCTGCGAGTCTG
AATATTTTTTTGCTTTGTGTCGCGTTTTAATGTGAAAAGAAAAACACTTT
TTCCACGGTTACGGGCGCAGAAATCAGTGCAAAACATTGCGAATACGGAG
TGCCCGAAAATGCAGGCGGGGCAGCACTAAGTCGGAGCCGCATCTCCCCC
GATTTCCGCCGTGCTGGCAGCCAACGTTGGCAGCCCGAATCCGAATCTCC
AGCGCACTCGTTTATTATTAAACAACGGGCAACGGAAACAGGGAAAGAAA
AACGCAGAGAATCCAAGCCAGAAAATATGTACAACAACGGGGCCAGGGGC
TTCTCCATTCACGACGCCTTCGAGGAGGAGACCGACGAGGCGATACGCGT
CTATGGCTCCACCGTGATATCCACGCCCATGAGAGGCAAGCAAGGTCGCT
CCACCGAAGACGTCTCCATCCGGATTCAGGACCCCAAGGGCTACAACAAG
TATGCCGAGGACACAACGTCCCGGGACAGCGACTCGCTCATCCAGGAGTA
CGGCAACCTGCCCACGGAGGAGACCAACACATACTGCTGGCGGCATCCCA
AGGTGCGTGAGAACTGGCGCACAGTGCTGGCCGCCTTTACGCTCCTGGTC
GTGGGCACGGGCCTCTTTGTGATGGGCACCTTTGCCATCGCGGATCCGCA
GAACACGTCGCAGGGAGTCGTGTTCTTCGTAGCGGGACTCATCTGCTTCA
TACCCGGGGCCTATCACGTCGTGTACATCTGGCTGGCAGCCAAAGGATAT
CGAGGGTTCGACTTCTATCACCTGCCGCTGTTCACATAAGCGTAAGCGGA
CATCTGGACAGTCGAGCTGGTTGATCCATGGACGAAGAGAGTGGGAGAAG
CCCCATCTATTAATATAAATCTGTGTTTGTTTATACCCGACCCGTATAAA
CAACTTATTTTCTACATTGTAATCGTAATTAACTCGAAACTTGGTTTGTG
TAACGTACTTTTTGTGTTTAGCGGCAAAAAATTTCGTTTAGACAAATATC
CCTTACCCCTGAAATCCGAATTGAAATCTAGCAATATATAGATTATATAT
TTTACAATATTTTCTATTATGTACTCGGTAAAGTGTTTTTTGTATGCCCC
TTCTCCAAAACCGAACCCAAGAAAGCGAAAAACATTCATACGTACACTCG
AAATTGATTTAAAAACAAAAAAAAAAAAAAAA

RH22148.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:05:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG12025.b 2156 CG12025.b 93..1314 2..1223 6095 99.9 Plus
CG12025-RA 1392 CG12025-RA 93..1314 2..1223 6095 99.9 Plus
CG12025.c 1874 CG12025.c 93..1314 2..1223 6095 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:23:00
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 1866697..1867431 482..1216 3645 99.7 Plus
chr3L 24539361 chr3L 1864994..1865480 2..488 2435 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:24:38 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:22:58
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 1867135..1867876 482..1223 3680 99.7 Plus
3L 28110227 3L 1865432..1865918 2..488 2435 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:36:42
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 1867135..1867876 482..1223 3680 99.7 Plus
3L 28103327 3L 1865432..1865918 2..488 2435 100 Plus
Blast to na_te.dros performed 2019-03-16 14:22:58
Subject Length Description Subject Range Query Range Score Percent Strand
INE-1 611 INE-1 INE1 611bp Derived from U66884 (e1371475) (Rel. 52, Last updated, Version 6). 255..293 117..79 114 76.9 Minus

RH22148.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:23:51 Download gff for RH22148.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 1864993..1865479 1..487 99 -> Plus
chr3L 1866703..1867431 488..1216 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:43:19 Download gff for RH22148.complete
Subject Subject Range Query Range Percent Splice Strand
CG12025-RA 1..513 327..839 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:47:39 Download gff for RH22148.complete
Subject Subject Range Query Range Percent Splice Strand
CG12025-RA 1..513 327..839 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:47:45 Download gff for RH22148.complete
Subject Subject Range Query Range Percent Splice Strand
CG12025-RA 1..513 327..839 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:40:04 Download gff for RH22148.complete
Subject Subject Range Query Range Percent Splice Strand
CG12025-RA 1..513 327..839 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:27:11 Download gff for RH22148.complete
Subject Subject Range Query Range Percent Splice Strand
CG12025-RA 1..513 327..839 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:23:54 Download gff for RH22148.complete
Subject Subject Range Query Range Percent Splice Strand
CG12025-RA 2..1216 2..1216 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:47:39 Download gff for RH22148.complete
Subject Subject Range Query Range Percent Splice Strand
CG12025-RA 1..1209 2..1210 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:47:45 Download gff for RH22148.complete
Subject Subject Range Query Range Percent Splice Strand
CG12025-RB 2..1217 1..1216 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:40:04 Download gff for RH22148.complete
Subject Subject Range Query Range Percent Splice Strand
CG12025-RA 2..1216 2..1216 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:27:11 Download gff for RH22148.complete
Subject Subject Range Query Range Percent Splice Strand
CG12025-RB 2..1217 1..1216 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:23:51 Download gff for RH22148.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1865431..1865917 1..487 99 -> Plus
3L 1867141..1867869 488..1216 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:23:51 Download gff for RH22148.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1865431..1865917 1..487 99 -> Plus
3L 1867141..1867869 488..1216 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:23:51 Download gff for RH22148.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1865431..1865917 1..487 99 -> Plus
3L 1867141..1867869 488..1216 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:47:45 Download gff for RH22148.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 1865431..1865917 1..487 99 -> Plus
arm_3L 1867141..1867869 488..1216 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:12:23 Download gff for RH22148.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1865431..1865917 1..487 99 -> Plus
3L 1867141..1867869 488..1216 99   Plus

RH22148.pep Sequence

Translation from 326 to 838

> RH22148.pep
MYNNGARGFSIHDAFEEETDEAIRVYGSTVISTPMRGKQGRSTEDVSIRI
QDPKGYNKYAEDTTSRDSDSLIQEYGNLPTEETNTYCWRHPKVRENWRTV
LAAFTLLVVGTGLFVMGTFAIADPQNTSQGVVFFVAGLICFIPGAYHVVY
IWLAAKGYRGFDFYHLPLFT*

RH22148.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 22:12:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24843-PA 170 GF24843-PA 1..170 1..170 884 98.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 22:12:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14832-PA 170 GG14832-PA 1..170 1..170 916 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 22:12:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16440-PA 176 GH16440-PA 1..176 1..170 885 94.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:20:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG12025-PC 170 CG12025-PC 1..170 1..170 910 100 Plus
CG12025-PB 170 CG12025-PB 1..170 1..170 910 100 Plus
CG12025-PA 170 CG12025-PA 1..170 1..170 910 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 22:12:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16695-PA 175 GI16695-PA 1..175 1..170 867 94.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 22:12:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25314-PA 171 GL25314-PA 1..171 1..170 902 98.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 22:12:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11347-PA 171 GA11347-PA 1..171 1..170 902 98.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 22:12:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14454-PA 170 GM14454-PA 1..170 1..170 916 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 22:12:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13654-PA 132 GD13654-PA 15..132 53..170 635 99.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 22:12:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12432-PA 176 GJ12432-PA 1..176 1..170 877 94.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 22:12:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12199-PA 179 GK12199-PA 1..179 1..170 867 92.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 22:12:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21195-PA 170 GE21195-PA 1..170 1..170 916 100 Plus

RH22148.hyp Sequence

Translation from 326 to 838

> RH22148.hyp
MYNNGARGFSIHDAFEEETDEAIRVYGSTVISTPMRGKQGRSTEDVSIRI
QDPKGYNKYAEDTTSRDSDSLIQEYGNLPTEETNTYCWRHPKVRENWRTV
LAAFTLLVVGTGLFVMGTFAIADPQNTSQGVVFFVAGLICFIPGAYHVVY
IWLAAKGYRGFDFYHLPLFT*

RH22148.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:55:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG12025-PC 170 CG12025-PC 1..170 1..170 910 100 Plus
CG12025-PB 170 CG12025-PB 1..170 1..170 910 100 Plus
CG12025-PA 170 CG12025-PA 1..170 1..170 910 100 Plus