RH23514.complete Sequence
756 bp (756 high quality bases) assembled on 2002-05-16
GenBank Submission: AY119164
> RH23514.complete
GAGTCATACCCGTGAGCTTAGATCAAACGAACGTCGTGCGTTTAAACGGA
GAAATGAAGAGCTGTGCGGCGATTGGAGTCCTTCTGGTACTGCTACTTCA
GTACGAAGTGGTTAGGACGGACAGCGATAGCAGCGACAGCAGCAGCAGCA
GCAGTGGAGAGAAGAAGCACAAGCACTCCAAGACGGAGCACAAGTACAAT
TATCCTGCATATCCTAATCCGGGCTATCCTCCGTATCAAGAAATGGGAGG
CTATCCTTCATATCTCTACAATCCGTACATGCCGTATCCTCCGTATCCTC
AAATGGGAGGCTATCCTTCATATCCCTACAATCTGTACATGCCCCCACCA
CCACCACCACCGCCACACCCGCAACAAGCTCCGCCACCATCAATGTATCC
ACCCGACCCGTCCGGATATCCAGGCGGCTATCCACCGCAGGGGGCTCCCG
GACAGAATCCAGTTAACAACCCAAATGCGATCCCCAATCAGCCTCAGGCA
CAGCAGCCTGCCAGCGGCCCGGGATCAGGGCCTGCCCCGAACTATCCTCC
AGGCGGCTCGAGCGTTATTAATCATTCCCTTAAGGTCAACAAGGAATACA
ACGAGGACGGTCACCACCAATCTTCAACGTAGTCGCAGTCGAGATACAAT
GTTACATGAAACTTTAAACGTCGGATTGGGCCTCAAGTTTCAAGTCGGCC
TTCAATACAATGTAGCAAAGTCGAATTAAAGATTTAAACAGCAAAAAAAA
AAAAAA
RH23514.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 20:55:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG16743-RA | 760 | CG16743-RA | 21..760 | 2..741 | 3700 | 100 | Plus |
CG16743.a | 944 | CG16743.a | 205..944 | 2..741 | 3700 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:23:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2L | 23010047 | chr2L | 10971355..10972094 | 2..741 | 3700 | 100 | Plus |
chr2L | 23010047 | chr2L | 10971578..10971636 | 285..343 | 220 | 91.5 | Plus |
chr2L | 23010047 | chr2L | 10971638..10971696 | 225..283 | 220 | 91.5 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:25:01 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:23:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 10972600..10973339 | 2..741 | 3700 | 100 | Plus |
2L | 23513712 | 2L | 10972823..10972881 | 285..343 | 220 | 91.5 | Plus |
2L | 23513712 | 2L | 10972883..10972941 | 225..283 | 220 | 91.5 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:14:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 10972600..10973339 | 2..741 | 3700 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-16 14:23:07 has no hits.
RH23514.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:23:56 Download gff for
RH23514.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2L | 10971746..10972094 | 393..742 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:43:36 Download gff for
RH23514.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG16743-RA | 1..579 | 54..632 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:53:06 Download gff for
RH23514.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG16743-RA | 1..579 | 54..632 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:48:21 Download gff for
RH23514.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG16743-RB | 92..723 | 1..632 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:35:32 Download gff for
RH23514.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG16743-RA | 1..579 | 54..632 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:27:16 Download gff for
RH23514.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG16743-RB | 92..723 | 1..632 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:05:09 Download gff for
RH23514.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG16743-RA | 20..760 | 1..742 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:53:06 Download gff for
RH23514.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG16743-RA | 20..760 | 1..741 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:48:21 Download gff for
RH23514.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG16743-RA | 2..742 | 1..741 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:35:32 Download gff for
RH23514.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG16743-RA | 20..760 | 1..742 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:27:16 Download gff for
RH23514.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG16743-RA | 2..742 | 1..741 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:23:56 Download gff for
RH23514.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 10972599..10973339 | 1..742 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:23:56 Download gff for
RH23514.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 10972599..10973339 | 1..742 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:23:56 Download gff for
RH23514.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 10972599..10973339 | 1..742 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:48:21 Download gff for
RH23514.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 10972599..10973339 | 1..742 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:17:55 Download gff for
RH23514.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 10972599..10973339 | 1..742 | 99 | | Plus |
RH23514.hyp Sequence
Translation from 2 to 631
> RH23514.hyp
VIPVSLDQTNVVRLNGEMKSCAAIGVLLVLLLQYEVVRTDSDSSDSSSSS
SGEKKHKHSKTEHKYNYPAYPNPGYPPYQEMGGYPSYLYNPYMPYPPYPQ
MGGYPSYPYNLYMPPPPPPPPHPQQAPPPSMYPPDPSGYPGGYPPQGAPG
QNPVNNPNAIPNQPQAQQPASGPGSGPAPNYPPGGSSVINHSLKVNKEYN
EDGHHQSST*
RH23514.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:12:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG16743-PB | 240 | CG16743-PB | 32..240 | 1..209 | 1181 | 100 | Plus |
CG16743-PA | 192 | CG16743-PA | 1..192 | 18..209 | 1098 | 100 | Plus |
CG15021-PA | 420 | CG15021-PA | 144..309 | 65..185 | 171 | 32.9 | Plus |
CG10555-PB | 926 | CG10555-PB | 455..604 | 56..183 | 165 | 31.1 | Plus |
CG10555-PA | 926 | CG10555-PA | 455..604 | 56..183 | 165 | 31.1 | Plus |
CG15021-PA | 420 | CG15021-PA | 140..285 | 71..188 | 164 | 36.2 | Plus |
CG15021-PA | 420 | CG15021-PA | 86..193 | 68..183 | 155 | 37.9 | Plus |
RH23514.pep Sequence
Translation from 53 to 631
> RH23514.pep
MKSCAAIGVLLVLLLQYEVVRTDSDSSDSSSSSSGEKKHKHSKTEHKYNY
PAYPNPGYPPYQEMGGYPSYLYNPYMPYPPYPQMGGYPSYPYNLYMPPPP
PPPPHPQQAPPPSMYPPDPSGYPGGYPPQGAPGQNPVNNPNAIPNQPQAQ
QPASGPGSGPAPNYPPGGSSVINHSLKVNKEYNEDGHHQSST*
RH23514.pep Blast Records
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:48:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG23687-PA | 187 | GG23687-PA | 1..187 | 1..192 | 374 | 69.7 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:16:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG16743-PA | 192 | CG16743-PA | 1..192 | 1..192 | 1098 | 100 | Plus |
CG16743-PB | 240 | CG16743-PB | 49..240 | 1..192 | 1098 | 100 | Plus |
CG15021-PA | 420 | CG15021-PA | 144..309 | 48..168 | 171 | 32.9 | Plus |
CG10555-PB | 926 | CG10555-PB | 455..604 | 39..166 | 165 | 31.1 | Plus |
CG10555-PA | 926 | CG10555-PA | 455..604 | 39..166 | 165 | 31.1 | Plus |
CG15021-PA | 420 | CG15021-PA | 140..285 | 54..171 | 164 | 36.2 | Plus |
Rb97D-PE | 434 | CG6354-PE | 273..409 | 48..180 | 161 | 35.5 | Plus |
Rb97D-PD | 434 | CG6354-PD | 273..409 | 48..180 | 161 | 35.5 | Plus |
Rb97D-PG | 465 | CG6354-PG | 273..409 | 48..180 | 161 | 35.5 | Plus |
Rb97D-PC | 465 | CG6354-PC | 273..409 | 48..180 | 161 | 35.5 | Plus |
Rb97D-PA | 465 | CG6354-PA | 273..409 | 48..180 | 161 | 35.5 | Plus |
Rb97D-PI | 471 | CG6354-PI | 273..409 | 48..180 | 161 | 35.5 | Plus |
Rb97D-PF | 471 | CG6354-PF | 273..409 | 48..180 | 161 | 35.5 | Plus |
Rb97D-PB | 471 | CG6354-PB | 273..409 | 48..180 | 161 | 35.5 | Plus |
Rb97D-PH | 471 | CG6354-PH | 273..409 | 48..180 | 161 | 35.5 | Plus |
CG15021-PA | 420 | CG15021-PA | 86..193 | 51..166 | 155 | 37.9 | Plus |
osa-PE | 2555 | CG7467-PE | 1166..1298 | 48..169 | 150 | 37.5 | Plus |
osa-PC | 2556 | CG7467-PC | 1167..1299 | 48..169 | 150 | 37.5 | Plus |
osa-PF | 2559 | CG7467-PF | 1170..1302 | 48..169 | 150 | 37.5 | Plus |
CG9411-PA | 993 | CG9411-PA | 96..229 | 35..166 | 149 | 36.5 | Plus |
CG43710-PA | 340 | CG43710-PA | 53..179 | 41..166 | 146 | 34.3 | Plus |
Bap111-PA | 749 | CG7055-PA | 601..718 | 50..169 | 146 | 37.3 | Plus |
CG15225-PB | 225 | CG15225-PB | 88..183 | 68..166 | 145 | 35.2 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:48:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM18772-PA | 191 | GM18772-PA | 1..191 | 1..192 | 475 | 87.1 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:48:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD23744-PA | 195 | GD23744-PA | 1..195 | 1..192 | 438 | 88.3 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:48:33
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE18499-PA | 186 | GE18499-PA | 1..186 | 1..192 | 418 | 68.8 | Plus |