Clone RH23514 Report

Search the DGRC for RH23514

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:235
Well:14
Vector:pFlc-1
Associated Gene/TranscriptCG16743-RA
Protein status:RH23514.pep: gold
Preliminary Size:696
Sequenced Size:756

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG16743 2002-01-01 Sim4 clustering to Release 2
CG16743 2002-05-16 Blastp of sequenced clone
CG16743 2003-01-01 Sim4 clustering to Release 3
CG16743 2008-04-29 Release 5.5 accounting
CG16743 2008-08-15 Release 5.9 accounting
CG16743 2008-12-18 5.12 accounting

Clone Sequence Records

RH23514.complete Sequence

756 bp (756 high quality bases) assembled on 2002-05-16

GenBank Submission: AY119164

> RH23514.complete
GAGTCATACCCGTGAGCTTAGATCAAACGAACGTCGTGCGTTTAAACGGA
GAAATGAAGAGCTGTGCGGCGATTGGAGTCCTTCTGGTACTGCTACTTCA
GTACGAAGTGGTTAGGACGGACAGCGATAGCAGCGACAGCAGCAGCAGCA
GCAGTGGAGAGAAGAAGCACAAGCACTCCAAGACGGAGCACAAGTACAAT
TATCCTGCATATCCTAATCCGGGCTATCCTCCGTATCAAGAAATGGGAGG
CTATCCTTCATATCTCTACAATCCGTACATGCCGTATCCTCCGTATCCTC
AAATGGGAGGCTATCCTTCATATCCCTACAATCTGTACATGCCCCCACCA
CCACCACCACCGCCACACCCGCAACAAGCTCCGCCACCATCAATGTATCC
ACCCGACCCGTCCGGATATCCAGGCGGCTATCCACCGCAGGGGGCTCCCG
GACAGAATCCAGTTAACAACCCAAATGCGATCCCCAATCAGCCTCAGGCA
CAGCAGCCTGCCAGCGGCCCGGGATCAGGGCCTGCCCCGAACTATCCTCC
AGGCGGCTCGAGCGTTATTAATCATTCCCTTAAGGTCAACAAGGAATACA
ACGAGGACGGTCACCACCAATCTTCAACGTAGTCGCAGTCGAGATACAAT
GTTACATGAAACTTTAAACGTCGGATTGGGCCTCAAGTTTCAAGTCGGCC
TTCAATACAATGTAGCAAAGTCGAATTAAAGATTTAAACAGCAAAAAAAA
AAAAAA

RH23514.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:55:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG16743-RA 760 CG16743-RA 21..760 2..741 3700 100 Plus
CG16743.a 944 CG16743.a 205..944 2..741 3700 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:23:09
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 10971355..10972094 2..741 3700 100 Plus
chr2L 23010047 chr2L 10971578..10971636 285..343 220 91.5 Plus
chr2L 23010047 chr2L 10971638..10971696 225..283 220 91.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:25:01 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:23:07
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10972600..10973339 2..741 3700 100 Plus
2L 23513712 2L 10972823..10972881 285..343 220 91.5 Plus
2L 23513712 2L 10972883..10972941 225..283 220 91.5 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:14:37
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10972600..10973339 2..741 3700 100 Plus
Blast to na_te.dros performed on 2019-03-16 14:23:07 has no hits.

RH23514.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:23:56 Download gff for RH23514.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 10971746..10972094 393..742 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:43:36 Download gff for RH23514.complete
Subject Subject Range Query Range Percent Splice Strand
CG16743-RA 1..579 54..632 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:53:06 Download gff for RH23514.complete
Subject Subject Range Query Range Percent Splice Strand
CG16743-RA 1..579 54..632 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:48:21 Download gff for RH23514.complete
Subject Subject Range Query Range Percent Splice Strand
CG16743-RB 92..723 1..632 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:35:32 Download gff for RH23514.complete
Subject Subject Range Query Range Percent Splice Strand
CG16743-RA 1..579 54..632 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:27:16 Download gff for RH23514.complete
Subject Subject Range Query Range Percent Splice Strand
CG16743-RB 92..723 1..632 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:05:09 Download gff for RH23514.complete
Subject Subject Range Query Range Percent Splice Strand
CG16743-RA 20..760 1..742 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:53:06 Download gff for RH23514.complete
Subject Subject Range Query Range Percent Splice Strand
CG16743-RA 20..760 1..741 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:48:21 Download gff for RH23514.complete
Subject Subject Range Query Range Percent Splice Strand
CG16743-RA 2..742 1..741 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:35:32 Download gff for RH23514.complete
Subject Subject Range Query Range Percent Splice Strand
CG16743-RA 20..760 1..742 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:27:16 Download gff for RH23514.complete
Subject Subject Range Query Range Percent Splice Strand
CG16743-RA 2..742 1..741 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:23:56 Download gff for RH23514.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10972599..10973339 1..742 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:23:56 Download gff for RH23514.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10972599..10973339 1..742 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:23:56 Download gff for RH23514.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10972599..10973339 1..742 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:48:21 Download gff for RH23514.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 10972599..10973339 1..742 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:17:55 Download gff for RH23514.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10972599..10973339 1..742 99   Plus

RH23514.hyp Sequence

Translation from 2 to 631

> RH23514.hyp
VIPVSLDQTNVVRLNGEMKSCAAIGVLLVLLLQYEVVRTDSDSSDSSSSS
SGEKKHKHSKTEHKYNYPAYPNPGYPPYQEMGGYPSYLYNPYMPYPPYPQ
MGGYPSYPYNLYMPPPPPPPPHPQQAPPPSMYPPDPSGYPGGYPPQGAPG
QNPVNNPNAIPNQPQAQQPASGPGSGPAPNYPPGGSSVINHSLKVNKEYN
EDGHHQSST*

RH23514.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:12:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG16743-PB 240 CG16743-PB 32..240 1..209 1181 100 Plus
CG16743-PA 192 CG16743-PA 1..192 18..209 1098 100 Plus
CG15021-PA 420 CG15021-PA 144..309 65..185 171 32.9 Plus
CG10555-PB 926 CG10555-PB 455..604 56..183 165 31.1 Plus
CG10555-PA 926 CG10555-PA 455..604 56..183 165 31.1 Plus
CG15021-PA 420 CG15021-PA 140..285 71..188 164 36.2 Plus
CG15021-PA 420 CG15021-PA 86..193 68..183 155 37.9 Plus

RH23514.pep Sequence

Translation from 53 to 631

> RH23514.pep
MKSCAAIGVLLVLLLQYEVVRTDSDSSDSSSSSSGEKKHKHSKTEHKYNY
PAYPNPGYPPYQEMGGYPSYLYNPYMPYPPYPQMGGYPSYPYNLYMPPPP
PPPPHPQQAPPPSMYPPDPSGYPGGYPPQGAPGQNPVNNPNAIPNQPQAQ
QPASGPGSGPAPNYPPGGSSVINHSLKVNKEYNEDGHHQSST*

RH23514.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:48:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23687-PA 187 GG23687-PA 1..187 1..192 374 69.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:16:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG16743-PA 192 CG16743-PA 1..192 1..192 1098 100 Plus
CG16743-PB 240 CG16743-PB 49..240 1..192 1098 100 Plus
CG15021-PA 420 CG15021-PA 144..309 48..168 171 32.9 Plus
CG10555-PB 926 CG10555-PB 455..604 39..166 165 31.1 Plus
CG10555-PA 926 CG10555-PA 455..604 39..166 165 31.1 Plus
CG15021-PA 420 CG15021-PA 140..285 54..171 164 36.2 Plus
Rb97D-PE 434 CG6354-PE 273..409 48..180 161 35.5 Plus
Rb97D-PD 434 CG6354-PD 273..409 48..180 161 35.5 Plus
Rb97D-PG 465 CG6354-PG 273..409 48..180 161 35.5 Plus
Rb97D-PC 465 CG6354-PC 273..409 48..180 161 35.5 Plus
Rb97D-PA 465 CG6354-PA 273..409 48..180 161 35.5 Plus
Rb97D-PI 471 CG6354-PI 273..409 48..180 161 35.5 Plus
Rb97D-PF 471 CG6354-PF 273..409 48..180 161 35.5 Plus
Rb97D-PB 471 CG6354-PB 273..409 48..180 161 35.5 Plus
Rb97D-PH 471 CG6354-PH 273..409 48..180 161 35.5 Plus
CG15021-PA 420 CG15021-PA 86..193 51..166 155 37.9 Plus
osa-PE 2555 CG7467-PE 1166..1298 48..169 150 37.5 Plus
osa-PC 2556 CG7467-PC 1167..1299 48..169 150 37.5 Plus
osa-PF 2559 CG7467-PF 1170..1302 48..169 150 37.5 Plus
CG9411-PA 993 CG9411-PA 96..229 35..166 149 36.5 Plus
CG43710-PA 340 CG43710-PA 53..179 41..166 146 34.3 Plus
Bap111-PA 749 CG7055-PA 601..718 50..169 146 37.3 Plus
CG15225-PB 225 CG15225-PB 88..183 68..166 145 35.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:48:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18772-PA 191 GM18772-PA 1..191 1..192 475 87.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:48:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23744-PA 195 GD23744-PA 1..195 1..192 438 88.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:48:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18499-PA 186 GE18499-PA 1..186 1..192 418 68.8 Plus