Clone RH23915 Report

Search the DGRC for RH23915

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:239
Well:15
Vector:pFlc-1
Associated Gene/TranscriptCG32280-RA
Protein status:RH23915.pep: gold
Sequenced Size:1126

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG32280-RA 2010-01-14 Manual selection by Sue Celniker

Clone Sequence Records

RH23915.complete Sequence

1126 bp assembled on 2010-02-11

GenBank Submission: BT120308.1

> RH23915.complete
GACTCTGCAACGTATCTCTCTCGGGGTAGTAAAATACGAGACACTCAACC
GCCAAGTGCATTTACTAGCCTAGCAACATGAGTAAACCTGGCAGTGCTCC
TCCGCAGTTCACCTATGTGCCGCCCCCTTCGGCCCCGCCCTCTTACCAGG
AGGCGGTGGGCGGAGTGAAGCCGGTGGGTCCATATACGCCCGTGGTGGCG
CCCGCAACCACGGCAAATACCACGATTGTGACCACGGTTGTGCCCATTAG
CCGCACTTCGACGCACATGATCTGTCCATCGTGCCATGCCGAGATCGAGA
CGACTACGCGCACCGAGCCGGGAATGATTGCCTACTTGTCCGGATTTTTG
ATTGCCCTATTTGGTTGCTGGCTGGGATGCTGCCTAATACCTTGCTGCAT
CGACGACTGCATGGATGTGCATCACTCGTGCCCCAACTGCCGCGCATATT
TGGGGCGATACCGTCGATAGGATTGAGCGAGCAGGTCCAGCAAGGGGTTC
CGTGGTGTAGATTGATTACTTTAAGCAAGCGTTTTTTGCCTTTATTTATT
TAATTGTAGTAATATCATTTGGATTCCACAGCGAAGGCAGATGGAAAGAG
CCAAGGCTTCCCTTAATCTAACGCTAACTCGCTAAATTGCTCCGCTGTTT
TACATTTTGGTTCGCCCAATCCTTAATTGTTATGTGTATGTTTCTGCCAC
GCTAAAGATAGTAAATACGTATACATTAAAATATCCAGCGCTTCGCGGAT
AGGACAGCCACTATAAAAACTCAAATAATGAATCCGCCTTTCTAGGTACC
CACATATGTATGTACAAGCCTGATTACGAGCACAAAAGTCGCTTGTGTGT
CCATTTTGAAGAACAGGCCCTTTGATATTGCACAAATTGTAAATCTTTTG
AAGTCCGTCTTATGTTTTTCGCACATTGTTTAATGAATAAATCGCTTAGA
ATGTAGTCAAAAGATAAAATACAACATATTTTTGTAACAAAGTGTAAATG
TCTTCAGCGAAAGTGCATATTGTATACTGTGAAAGTTAATCTCCCTAATA
ATTAATCACGAAATCTATATAATTGACTTTTAATTTTTAAATAAACTTAA
AAATGTCACCAAAAAAAAAAAAAAAA

RH23915.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:44:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG32280-RA 1216 CG32280-RA 23..1134 2..1113 5560 100 Plus
CG32280-RB 1249 CG32280-RB 93..1167 39..1113 5375 100 Plus
CG32280.b 1341 CG32280.b 187..1259 41..1113 5365 100 Plus
CG32280-RB 1249 CG32280-RB 23..61 2..40 195 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 17:12:13
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 3167783..3168529 364..1110 3735 100 Plus
chr3L 24539361 chr3L 3167389..3167714 39..364 1630 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:25:07 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 17:12:10
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3168334..3169083 364..1113 3750 100 Plus
3L 28110227 3L 3167940..3168265 39..364 1630 100 Plus
3L 28110227 3L 3165183..3165221 2..40 195 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:42:12
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 3168334..3169083 364..1113 3750 100 Plus
3L 28103327 3L 3167940..3168265 39..364 1630 100 Plus
3L 28103327 3L 3165183..3165221 2..40 195 100 Plus
Blast to na_te.dros performed 2019-03-15 17:12:11
Subject Length Description Subject Range Query Range Score Percent Strand
Doc4-element 2791 Doc4-element DOC4 2791bp 2582..2683 439..336 118 61 Minus
gypsy12 10218 gypsy12 GYPSY12 10218bp 1884..1932 1070..1024 114 73.5 Minus
gypsy12 10218 gypsy12 GYPSY12 10218bp 9766..9814 1070..1024 114 73.5 Minus

RH23915.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 17:13:25 Download gff for RH23915.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 3164629..3164666 1..40 92 -> Plus
chr3L 3167391..3167714 41..364 100 -> Plus
chr3L 3167784..3168529 365..1110 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-02-11 10:06:12 Download gff for RH23915.complete
Subject Subject Range Query Range Percent Splice Strand
CG32280-RC 1..393 78..470 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:23:23 Download gff for RH23915.complete
Subject Subject Range Query Range Percent Splice Strand
CG32280-RC 1..393 78..470 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:28:22 Download gff for RH23915.complete
Subject Subject Range Query Range Percent Splice Strand
CG32280-RA 1..393 78..470 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:28:04 Download gff for RH23915.complete
Subject Subject Range Query Range Percent Splice Strand
CG32280-RB 1..393 78..470 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-02-11 10:06:11 Download gff for RH23915.complete
Subject Subject Range Query Range Percent Splice Strand
CG32280-RA 2..1110 2..1110 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:23:23 Download gff for RH23915.complete
Subject Subject Range Query Range Percent Splice Strand
CG32280-RA 2..1110 2..1110 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:28:22 Download gff for RH23915.complete
Subject Subject Range Query Range Percent Splice Strand
CG32280-RA 2..1111 1..1110 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:28:04 Download gff for RH23915.complete
Subject Subject Range Query Range Percent Splice Strand
CG32280-RA 2..1111 1..1110 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:13:25 Download gff for RH23915.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3165182..3165221 1..40 97 -> Plus
3L 3167942..3168265 41..364 100 -> Plus
3L 3168335..3169080 365..1110 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:13:25 Download gff for RH23915.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3165182..3165221 1..40 97 -> Plus
3L 3167942..3168265 41..364 100 -> Plus
3L 3168335..3169080 365..1110 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:13:25 Download gff for RH23915.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3165182..3165221 1..40 97 -> Plus
3L 3167942..3168265 41..364 100 -> Plus
3L 3168335..3169080 365..1110 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:28:22 Download gff for RH23915.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3165182..3165221 1..40 97 -> Plus
arm_3L 3167942..3168265 41..364 100 -> Plus
arm_3L 3168335..3169080 365..1110 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:10:57 Download gff for RH23915.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3167942..3168265 41..364 100 -> Plus
3L 3168335..3169080 365..1110 100   Plus
3L 3165182..3165221 1..40 97 -> Plus

RH23915.hyp Sequence

Translation from 77 to 469

> RH23915.hyp
MSKPGSAPPQFTYVPPPSAPPSYQEAVGGVKPVGPYTPVVAPATTANTTI
VTTVVPISRTSTHMICPSCHAEIETTTRTEPGMIAYLSGFLIALFGCWLG
CCLIPCCIDDCMDVHHSCPNCRAYLGRYRR*

RH23915.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:49:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG32280-PD 130 CG32280-PD 1..130 1..130 728 100 Plus
CG32280-PC 130 CG32280-PC 1..130 1..130 728 100 Plus
CG32280-PB 130 CG32280-PB 1..130 1..130 728 100 Plus
CG32280-PA 130 CG32280-PA 1..130 1..130 728 100 Plus
CG13510-PC 129 CG13510-PC 6..127 15..128 217 36.6 Plus

RH23915.pep Sequence

Translation from 77 to 469

> RH23915.pep
MSKPGSAPPQFTYVPPPSAPPSYQEAVGGVKPVGPYTPVVAPATTANTTI
VTTVVPISRTSTHMICPSCHAEIETTTRTEPGMIAYLSGFLIALFGCWLG
CCLIPCCIDDCMDVHHSCPNCRAYLGRYRR*

RH23915.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 20:22:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24273-PA 125 GF24273-PA 1..125 1..130 618 93.9 Plus
Dana\GF11281-PA 129 GF11281-PA 47..129 47..130 177 41.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 20:22:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14910-PA 130 GG14910-PA 1..130 1..130 672 99.2 Plus
Dere\GG21061-PA 129 GG21061-PA 47..129 47..130 174 41.7 Plus
Dere\GG22861-PA 113 GG22861-PA 12..103 20..126 166 35.5 Plus
Dere\GG22779-PA 128 GG22779-PA 4..126 5..129 132 31 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 20:22:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15394-PA 129 GH15394-PA 1..129 1..130 565 83.1 Plus
Dgri\GH19762-PA 102 GH19762-PA 20..101 47..129 177 43.4 Plus
Dgri\GH19761-PA 135 GH19761-PA 53..135 47..130 168 39.3 Plus
Dgri\GH19766-PA 130 GH19766-PA 10..130 3..130 133 33.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:23:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG32280-PD 130 CG32280-PD 1..130 1..130 728 100 Plus
CG32280-PC 130 CG32280-PC 1..130 1..130 728 100 Plus
CG32280-PB 130 CG32280-PB 1..130 1..130 728 100 Plus
CG32280-PA 130 CG32280-PA 1..130 1..130 728 100 Plus
CG13510-PC 129 CG13510-PC 6..127 15..128 217 36.6 Plus
CG13510-PB 129 CG13510-PB 6..127 15..128 217 36.6 Plus
CG13510-PA 129 CG13510-PA 6..127 15..128 217 36.6 Plus
CG13559-PA 114 CG13559-PA 8..103 16..126 211 39.6 Plus
CG30269-PB 144 CG30269-PB 21..143 7..130 171 32 Plus
CG30269-PA 144 CG30269-PA 21..143 7..130 171 32 Plus
CG30273-PB 128 CG30273-PB 6..125 3..128 157 29.2 Plus
CG4250-PB 134 CG4250-PB 15..133 15..129 149 32.5 Plus
CG4250-PA 121 CG4250-PA 15..120 15..129 147 32.2 Plus
CG42565-PB 135 CG42565-PB 9..135 7..128 146 28.1 Plus
CG42565-PA 135 CG42565-PA 9..135 7..128 146 28.1 Plus
CG13516-PB 168 CG13516-PB 37..161 4..128 141 27 Plus
CG13516-PA 168 CG13516-PA 37..161 4..128 141 27 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 20:22:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13000-PA 130 GI13000-PA 1..130 1..130 589 86.2 Plus
Dmoj\GI20298-PA 135 GI20298-PA 16..135 3..130 181 35.9 Plus
Dmoj\GI20299-PA 103 GI20299-PA 4..103 29..130 169 40.2 Plus
Dmoj\GI20305-PA 122 GI20305-PA 8..122 13..130 158 31.8 Plus
Dmoj\GI20300-PA 165 GI20300-PA 61..161 32..126 140 32.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 20:22:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21680-PA 131 GL21680-PA 1..131 1..130 626 91.6 Plus
Dper\GL11361-PA 129 GL11361-PA 47..129 47..130 173 40.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 20:22:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16808-PA 131 GA16808-PA 1..131 1..130 626 91.6 Plus
Dpse\GA12335-PA 129 GA12335-PA 47..129 47..130 173 40.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 20:22:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14539-PA 130 GM14539-PA 1..130 1..130 675 100 Plus
Dsec\GM16019-PA 114 GM16019-PA 8..103 16..126 190 39.6 Plus
Dsec\GM15931-PA 129 GM15931-PA 47..129 47..130 175 41.7 Plus
Dsec\GM15937-PA 144 GM15937-PA 21..143 6..130 154 37.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 20:22:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13732-PA 130 GD13732-PA 1..130 1..130 675 100 Plus
Dsim\GD11684-PA 129 GD11684-PA 47..129 47..130 175 41.7 Plus
Dsim\GD11691-PA 144 GD11691-PA 21..143 6..130 150 38 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 20:22:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13143-PA 129 GJ13143-PA 1..129 1..130 573 85.4 Plus
Dvir\GJ22026-PA 137 GJ22026-PA 19..137 4..130 185 37.8 Plus
Dvir\GJ22027-PA 152 GJ22027-PA 70..148 47..126 137 35 Plus
Dvir\GJ22030-PA 99 GJ22030-PA 27..99 57..130 133 37.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 20:22:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17763-PA 131 GK17763-PA 1..131 1..130 623 91.6 Plus
Dwil\GK21440-PA 130 GK21440-PA 48..130 47..130 174 40.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 20:22:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20364-PA 130 GE20364-PA 1..130 1..130 672 99.2 Plus
Dyak\GE14296-PA 114 GE14296-PA 12..103 20..126 194 43 Plus
Dyak\GE14003-PA 128 GE14003-PA 46..128 47..130 175 41.7 Plus
Dyak\GE14009-PA 148 GE14009-PA 30..147 17..130 137 35.8 Plus