Clone RH24125 Report

Search the DGRC for RH24125

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:241
Well:25
Vector:pFlc-1
Associated Gene/TranscriptCpr60D-RA
Protein status:RH24125.pep: gold
Sequenced Size:511

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG30163 2002-10-24 Blastp of sequenced clone
CG30163 2003-01-01 Sim4 clustering to Release 3
Cpr60D 2008-04-29 Release 5.5 accounting
Cpr60D 2008-08-15 Release 5.9 accounting
Cpr60D 2008-12-18 5.12 accounting

Clone Sequence Records

RH24125.complete Sequence

511 bp (511 high quality bases) assembled on 2002-10-24

GenBank Submission: BT001790

> RH24125.complete
GATTCATTAGCAGATGCGATTGAAACCCGTTTAGTGGGCTAGGCAGCTTC
GGAGTATAGTATAAAAGGCCGACGGGCATTGTTTCATTTCAAGAAGCTGC
TCCAAAATGCTGAAATATAGCCTTATCTTTGCCCTTTTCGTCGTTTTGGC
CAGCTGCAGTGAGGAGGATCTGCAGGCGCAACTTCTGAAGTCGGAGAACC
GCCAGAACCTGGATGGAGCTGGGCAGTTCCAGCATGAGATCACGGTCAGC
AATGGGATCCAAGTGAAAGCTCAAGGCAATGTGAACGGCATCCAGGGCGA
ATACTTCCTTCCCGGCGAAGATGGCAAGCAAATTCGCGTGACTTACACCG
CAGATGCAACCGGCTTCCATCCGAAGGTTGAAGAGTGACCGAGTGACCTT
GATGTTATGTTAATCTTAACTTATAAAACGGCGGTTTTTTCCATAAAATG
AGTGGTGAGGTAATGTCTTGTTGTTCCAATAAAACGTTCCCCTGGCAAAA
AAAAAAAAAAA

RH24125.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:53:20
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr60D-RA 702 Cpr60D-RA 36..528 3..495 2450 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:23:18
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 20548748..20549124 495..119 1870 99.7 Minus
chr2R 21145070 chr2R 20549183..20549298 118..3 580 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:25:09 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:23:16
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24662856..24663232 495..119 1870 99.7 Minus
2R 25286936 2R 24663291..24663406 118..3 580 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:12:42
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 24664055..24664431 495..119 1870 99.7 Minus
2R 25260384 2R 24664490..24664605 118..3 580 100 Minus
Blast to na_te.dros performed on 2019-03-16 14:23:16 has no hits.

RH24125.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:23:59 Download gff for RH24125.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 20548747..20549124 119..496 99 <- Minus
chr2R 20549183..20549298 1..118 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:43:39 Download gff for RH24125.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr60D-RA 1..282 107..388 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:50:09 Download gff for RH24125.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr60D-RA 1..282 107..388 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:48:56 Download gff for RH24125.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr60D-RA 1..282 107..388 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:32:17 Download gff for RH24125.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr60D-RA 1..282 107..388 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:27:20 Download gff for RH24125.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr60D-RA 1..282 107..388 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:00:53 Download gff for RH24125.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr60D-RA 1..493 3..496 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:50:09 Download gff for RH24125.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr60D-RA 1..493 3..496 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:48:56 Download gff for RH24125.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr60D-RA 1..493 3..496 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:32:17 Download gff for RH24125.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr60D-RA 1..493 3..496 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:27:20 Download gff for RH24125.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr60D-RA 1..493 3..496 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:23:59 Download gff for RH24125.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24662855..24663232 119..496 99 <- Minus
2R 24663291..24663406 1..118 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:23:59 Download gff for RH24125.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24662855..24663232 119..496 99 <- Minus
2R 24663291..24663406 1..118 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:23:59 Download gff for RH24125.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24662855..24663232 119..496 99 <- Minus
2R 24663291..24663406 1..118 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:48:56 Download gff for RH24125.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 20550378..20550755 119..496 99 <- Minus
arm_2R 20550814..20550929 1..118 98   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:12:16 Download gff for RH24125.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24664072..24664449 119..496 99 <- Minus
2R 24664508..24664623 1..118 98   Minus

RH24125.pep Sequence

Translation from 106 to 387

> RH24125.pep
MLKYSLIFALFVVLASCSEEDLQAQLLKSENRQNLDGAGQFQHEITVSNG
IQVKAQGNVNGIQGEYFLPGEDGKQIRVTYTADATGFHPKVEE*

RH24125.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:55:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11916-PA 92 GF11916-PA 1..91 1..91 397 79.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:55:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19905-PA 93 GG19905-PA 1..93 1..93 478 96.8 Plus
Dere\GG13245-PA 121 GG13245-PA 2..87 4..89 146 33.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:55:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21573-PA 93 GH21573-PA 1..92 1..91 271 59.4 Plus
Dgri\GH21570-PA 81 GH21570-PA 12..81 8..92 155 43.5 Plus
Dgri\GH15299-PA 118 GH15299-PA 2..89 4..89 154 38.2 Plus
Dgri\GH16160-PA 120 GH16160-PA 1..87 1..89 143 34.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:58:43
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr60D-PB 93 CG30163-PB 1..93 1..93 475 100 Plus
Cpr60D-PA 93 CG30163-PA 1..93 1..93 475 100 Plus
Edg78E-PB 122 CG7673-PB 2..87 4..89 150 32.6 Plus
Edg78E-PA 122 CG7673-PA 2..87 4..89 150 32.6 Plus
Cpr78Cc-PA 119 CG7658-PA 1..91 1..90 134 34.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:55:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19542-PA 97 GI19542-PA 26..96 20..91 253 65.3 Plus
Dmoj\GI12010-PA 117 GI12010-PA 1..89 1..89 163 41.1 Plus
Dmoj\GI13312-PA 120 GI13312-PA 1..87 1..89 140 34.8 Plus
Dmoj\GI19544-PA 132 GI19544-PA 1..88 1..89 138 36.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:55:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10997-PA 92 GL10997-PA 1..91 1..91 398 82.4 Plus
Dper\GL10999-PA 147 GL10999-PA 1..86 1..89 148 33.7 Plus
Dper\GL24590-PA 121 GL24590-PA 2..87 4..89 136 31.4 Plus
Dper\GL24679-PA 120 GL24679-PA 4..91 2..90 136 36 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:55:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15689-PA 97 GA15689-PA 1..90 1..90 401 84.4 Plus
Dpse\GA24564-PA 147 GA24564-PA 1..86 1..89 148 33.7 Plus
Dpse\GA20507-PA 120 GA20507-PA 4..91 2..90 137 36 Plus
Dpse\GA20516-PA 121 GA20516-PA 2..87 4..89 133 31.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:55:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11807-PA 93 GM11807-PA 1..93 1..93 469 96.8 Plus
Dsec\GM22150-PA 122 GM22150-PA 2..87 4..89 144 32.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:55:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24931-PA 93 GD24931-PA 1..93 1..93 476 97.8 Plus
Dsim\GD12126-PA 122 GD12126-PA 2..87 4..89 144 32.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:55:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21115-PA 105 GJ21115-PA 40..104 26..91 238 68.2 Plus
Dvir\GJ13281-PA 119 GJ13281-PA 1..90 1..90 152 39.6 Plus
Dvir\GJ12082-PA 120 GJ12082-PA 1..87 1..89 140 33.7 Plus
Dvir\GJ21116-PA 156 GJ21116-PA 21..110 2..90 132 31.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:55:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21874-PA 192 GK21874-PA 1..70 11..79 204 55.7 Plus
Dwil\GK21874-PA 192 GK21874-PA 67..153 2..90 148 32.6 Plus
Dwil\GK20425-PA 121 GK20425-PA 2..87 4..89 138 32.6 Plus
Dwil\GK20466-PA 121 GK20466-PA 2..92 1..90 131 34.8 Plus
Dwil\GK21650-PA 91 GK21650-PA 1..89 2..91 129 30.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:55:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11430-PA 93 GE11430-PA 1..93 1..93 474 95.7 Plus
Dyak\GE22345-PA 121 GE22345-PA 2..87 4..89 139 32.6 Plus
Dyak\GE22714-PA 120 GE22714-PA 4..86 7..89 133 32.5 Plus

RH24125.hyp Sequence

Translation from 106 to 387

> RH24125.hyp
MLKYSLIFALFVVLASCSEEDLQAQLLKSENRQNLDGAGQFQHEITVSNG
IQVKAQGNVNGIQGEYFLPGEDGKQIRVTYTADATGFHPKVEE*

RH24125.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:15:08
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr60D-PB 93 CG30163-PB 1..93 1..93 475 100 Plus
Cpr60D-PA 93 CG30163-PA 1..93 1..93 475 100 Plus
Edg78E-PB 122 CG7673-PB 2..87 4..89 150 32.6 Plus
Edg78E-PA 122 CG7673-PA 2..87 4..89 150 32.6 Plus
Cpr78Cc-PA 119 CG7658-PA 1..91 1..90 134 34.1 Plus